BLASTX nr result
ID: Paeonia23_contig00041245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041245 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETW84528.1| hypothetical protein HETIRDRAFT_433320 [Heterobas... 58 2e-06 gb|EPT03091.1| hypothetical protein FOMPIDRAFT_1022468 [Fomitops... 56 5e-06 >gb|ETW84528.1| hypothetical protein HETIRDRAFT_433320 [Heterobasidion irregulare TC 32-1] Length = 411 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 114 KRATDSDFLVLQFARVLEQLETQFYTQALAKFQPADFL 1 + TD++ LVLQFA VLEQLETQFYTQAL KFQ +DF+ Sbjct: 23 RTVTDNNLLVLQFANVLEQLETQFYTQALQKFQTSDFI 60 >gb|EPT03091.1| hypothetical protein FOMPIDRAFT_1022468 [Fomitopsis pinicola FP-58527 SS1] Length = 629 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 114 KRATDSDFLVLQFARVLEQLETQFYTQALAKFQPADF 4 +RA D+D VLQFA VLE LETQFY+QALAKFQ +DF Sbjct: 24 RRANDADVTVLQFAGVLEDLETQFYSQALAKFQASDF 60