BLASTX nr result
ID: Paeonia23_contig00040076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040076 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379307.1| hypothetical protein POPTR_0009s14580g [Popu... 61 1e-07 gb|EXC31564.1| Cytochrome P450 87A3 [Morus notabilis] 58 1e-06 ref|XP_002306227.2| hypothetical protein POPTR_0004s19450g [Popu... 58 1e-06 gb|EXC31565.1| Cytochrome P450 87A3 [Morus notabilis] 56 6e-06 >ref|XP_006379307.1| hypothetical protein POPTR_0009s14580g [Populus trichocarpa] gi|550331727|gb|ERP57104.1| hypothetical protein POPTR_0009s14580g [Populus trichocarpa] Length = 269 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 289 DKFLTGDFIA*LMFAVLFADFDSILSMIILAFKLLSDHPSVLQELTV 149 +KFLT DFI L+F +LFA F+SI + + LA KL+ DHPSVL+ELTV Sbjct: 89 EKFLTEDFIVNLIFGILFASFESISAALTLALKLIGDHPSVLEELTV 135 >gb|EXC31564.1| Cytochrome P450 87A3 [Morus notabilis] Length = 415 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -3 Query: 289 DKFLTGDFIA*LMFAVLFADFDSILSMIILAFKLLSDHPSVLQELT 152 +KFLT DF+A + F VL A F+++ + + LAFKLL+DHPSVL+ELT Sbjct: 205 EKFLTEDFVAHMTFGVLLATFETLSATMTLAFKLLADHPSVLEELT 250 >ref|XP_002306227.2| hypothetical protein POPTR_0004s19450g [Populus trichocarpa] gi|550341388|gb|EEE86738.2| hypothetical protein POPTR_0004s19450g [Populus trichocarpa] Length = 486 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = -3 Query: 289 DKFLTGDFIA*LMFAVLFADFDSILSMIILAFKLLSDHPSVLQELTV 149 +KFLT DF L+F +LFA F+SI + + L+ KL+ DHPSVL+ELTV Sbjct: 266 EKFLTEDFTVNLIFGILFASFESISAALTLSLKLIGDHPSVLEELTV 312 >gb|EXC31565.1| Cytochrome P450 87A3 [Morus notabilis] Length = 412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -3 Query: 295 NTDKFLTGDFIA*LMFAVLFADFDSILSMIILAFKLLSDHPSVLQEL 155 N +KFL+ DFI L+F LFA F+S+ +++ LAF+LLS+HPSVL+E+ Sbjct: 264 NKEKFLSEDFIVQLIFGGLFATFESVSAIMALAFELLSEHPSVLKEM 310