BLASTX nr result
ID: Paeonia23_contig00036196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00036196 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 emb|CBI19926.3| unnamed protein product [Vitis vinifera] 78 1e-12 emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] 78 1e-12 ref|XP_006581604.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006472888.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Vitis vinifera] Length = 665 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -1 Query: 300 VKKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYIYEQYDKVGAEG 121 V+KVIG S IGI+NH FVF QLLH GGK+IY +L LL++E++++GY +QYDKV A G Sbjct: 603 VRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVG 662 Query: 120 E 118 E Sbjct: 663 E 663 >emb|CBI19926.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -1 Query: 300 VKKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYIYEQYDKVGAEG 121 V+KVIG S IGI+NH FVF QLLH GGK+IY +L LL++E++++GY +QYDKV A G Sbjct: 350 VRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVG 409 Query: 120 E 118 E Sbjct: 410 E 410 >emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] Length = 1796 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -1 Query: 300 VKKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYIYEQYDKVGAEG 121 V+KVIG S IGI+NH FVF QLLH GGK+IY +L LL++E++++GY +QYDKV A G Sbjct: 1276 VRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGYASQQYDKVRAVG 1335 Query: 120 E 118 E Sbjct: 1336 E 1336 >ref|XP_006581604.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -1 Query: 297 KKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYI 154 K+ IG S IGIRN+ + F S QL HYGGK++Y +L LL+ EM+ EGY+ Sbjct: 583 KEFIGHSWIGIRNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 630 >ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -1 Query: 297 KKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYI 154 K+ IG S IGI+N+ + F S QL HYGGK++Y +L LL+ EM+ EGY+ Sbjct: 583 KEFIGHSWIGIKNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 630 >ref|XP_006472888.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Citrus sinensis] Length = 640 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/60 (45%), Positives = 41/60 (68%) Frame = -1 Query: 300 VKKVIGWSSIGIRNHEFVFMSTQLLHYGGKEIYSMLELLMREMKNEGYIYEQYDKVGAEG 121 + KV G S IGI+N + F + +L H+GG++IY +L LL EM++EG +Y + DK+ EG Sbjct: 580 INKVTGCSWIGIKNRIYTFNAGELQHHGGQKIYLVLRLLTWEMEDEGCVYLECDKLDVEG 639