BLASTX nr result
ID: Paeonia23_contig00036080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00036080 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrio... 68 2e-09 >ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] gi|403311617|gb|AFR34365.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] Length = 107 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 135 SDLPLRKVSSRQLNLSGKLLGAPHGLVKGRGDFLFIRG 22 SDLPLRKVSSRQLNL GKL+GAPHGLV GRG+ LFIRG Sbjct: 63 SDLPLRKVSSRQLNLPGKLVGAPHGLVIGRGECLFIRG 100