BLASTX nr result
ID: Paeonia23_contig00034208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00034208 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533960.1| Myosin-1, putative [Ricinus communis] gi|223... 60 4e-07 gb|EXC35462.1| hypothetical protein L484_026769 [Morus notabilis] 57 2e-06 ref|XP_007047781.1| Kinase interacting family protein, putative ... 55 8e-06 ref|XP_007206787.1| hypothetical protein PRUPE_ppa026542mg [Prun... 55 8e-06 >ref|XP_002533960.1| Myosin-1, putative [Ricinus communis] gi|223526073|gb|EEF28429.1| Myosin-1, putative [Ricinus communis] Length = 1089 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +2 Query: 2 QVVNQNVKDLNNNLQTHFAEAHCNVNHLSEKLHTMKLDKK 121 Q +N++V+D NNNLQT+F EAHCN++HLSEKLH +K D++ Sbjct: 427 QELNRSVEDQNNNLQTNFTEAHCNLDHLSEKLHNVKPDEE 466 >gb|EXC35462.1| hypothetical protein L484_026769 [Morus notabilis] Length = 951 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +2 Query: 2 QVVNQNVKDLNNNLQTHFAEAHCNVNHLSEKLHTMKLDKK 121 QV+NQ+ K+ NNNLQTHF EA CN++HLS+KL ++K D++ Sbjct: 398 QVLNQSFKEQNNNLQTHFTEARCNLDHLSDKLQSVKPDEE 437 >ref|XP_007047781.1| Kinase interacting family protein, putative [Theobroma cacao] gi|508700042|gb|EOX91938.1| Kinase interacting family protein, putative [Theobroma cacao] Length = 1031 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/40 (55%), Positives = 35/40 (87%) Frame = +2 Query: 2 QVVNQNVKDLNNNLQTHFAEAHCNVNHLSEKLHTMKLDKK 121 Q +NQ+++D NNNLQTHF EAHC ++HLSEK+++++ D++ Sbjct: 427 QGLNQSIEDQNNNLQTHFTEAHCYLDHLSEKMNSVQPDEE 466 >ref|XP_007206787.1| hypothetical protein PRUPE_ppa026542mg [Prunus persica] gi|462402429|gb|EMJ07986.1| hypothetical protein PRUPE_ppa026542mg [Prunus persica] Length = 1065 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = +2 Query: 2 QVVNQNVKDLNNNLQTHFAEAHCNVNHLSEKLHTMKLDKK 121 Q +NQ+V++ N+NLQTHF EAHCN+ H+S KL T+K D++ Sbjct: 429 QDLNQSVENQNDNLQTHFTEAHCNLGHISHKLRTVKPDEE 468