BLASTX nr result
ID: Paeonia23_contig00033982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033982 (454 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83231.1| hypothetical protein VITISV_018480 [Vitis vinifera] 57 2e-06 >emb|CAN83231.1| hypothetical protein VITISV_018480 [Vitis vinifera] Length = 357 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%) Frame = -1 Query: 220 RPQPAYQQVRCTICLCDFI*EESLISLPHCLHAFHAKFMDPYFTESGTTCLICRQPISFS 41 +P + ++ C +CLCD + E L LP C H FH +D +F ++ +TC +CR +S Sbjct: 53 KPNRTHXZIYCVVCLCDAVEGERLRRLPDCKHCFHVGCIDAWF-QAHSTCPLCRSQVSLP 111 Query: 40 HR-----YDFFISCMYL 5 HR + F+S + L Sbjct: 112 HRRQPTLFSHFLSLLKL 128