BLASTX nr result
ID: Paeonia23_contig00033904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033904 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208006.1| hypothetical protein PRUPE_ppa003717mg [Prun... 63 5e-08 ref|XP_004302802.1| PREDICTED: ankyrin repeat-containing protein... 60 2e-07 >ref|XP_007208006.1| hypothetical protein PRUPE_ppa003717mg [Prunus persica] gi|462403648|gb|EMJ09205.1| hypothetical protein PRUPE_ppa003717mg [Prunus persica] Length = 554 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 119 MEAPVRQPSLGQNKMTKQLTGKREGSPLHLAAREGNLEL 3 MEAPVRQ S + KMTKQLTGKRE +PLHLAAR+GNL L Sbjct: 1 MEAPVRQQSFSEKKMTKQLTGKREDTPLHLAARQGNLGL 39 >ref|XP_004302802.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Fragaria vesca subsp. vesca] Length = 543 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 119 MEAPVRQPSLGQNKMTKQLTGKREGSPLHLAAREGNLEL 3 MEAPVRQ S + KMTKQLTGKRE +PLHLAAR GNL L Sbjct: 1 MEAPVRQQSFCEKKMTKQLTGKREDAPLHLAARTGNLGL 39