BLASTX nr result
ID: Paeonia23_contig00033317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033317 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217436.1| hypothetical protein PRUPE_ppb014563mg [Prun... 65 1e-08 >ref|XP_007217436.1| hypothetical protein PRUPE_ppb014563mg [Prunus persica] gi|462413586|gb|EMJ18635.1| hypothetical protein PRUPE_ppb014563mg [Prunus persica] Length = 189 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = +3 Query: 117 IPRFNGEHYDYCSSNVKVMRKSKELWSIVEEGFEVPEDESKLAEAQK 257 IPRFN ++YDY S+N+KV+ K+ ELW++VE+G+E PEDE L +AQ+ Sbjct: 16 IPRFNDDNYDYWSNNMKVLPKAVELWNMVEDGYEEPEDEQALTQAQR 62