BLASTX nr result
ID: Paeonia23_contig00032295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032295 (757 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66538.1| hypothetical protein L484_017777 [Morus notabilis] 58 3e-06 >gb|EXB66538.1| hypothetical protein L484_017777 [Morus notabilis] Length = 758 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +2 Query: 2 CKLLDHRYGKEVVTEGRRASSD*GTVVHCEKLGTNAVNVWVDKAKVPQAPLWRASFD*TE 181 CK++D E+V EGRR+S+D +VH LG NA+ VWVD K P A LWR + + T Sbjct: 680 CKIMDWTGSGEIVAEGRRSSTDPKALVHNIPLGPNAMRVWVDVVKKPDAFLWRPTSEMTS 739 Query: 182 I 184 I Sbjct: 740 I 740