BLASTX nr result
ID: Paeonia23_contig00032110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032110 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 55 8e-06 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 301 KIASLNACQVIFGSPYLWD*NAIFHWRERKYLLTKDGKRVHKVLHSTKHR 152 ++ L+ CQVI GSPYLWD +AI + R RKY L KDGK H +++ KH+ Sbjct: 465 EVVPLDVCQVILGSPYLWDRDAIHYRRLRKYRLVKDGKEFH--INACKHQ 512