BLASTX nr result
ID: Paeonia23_contig00031456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00031456 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC11734.1| hypothetical protein L484_020789 [Morus notabilis] 56 6e-06 >gb|EXC11734.1| hypothetical protein L484_020789 [Morus notabilis] Length = 211 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -1 Query: 141 PIVENIKKRLDGWKKA*LSKGGKLILI*VLCANISVYYLSLVKI 10 P++E + KRLDGWK + LSKGG+L LI + A+I +YY+SL KI Sbjct: 20 PMIEKVSKRLDGWKNSFLSKGGRLTLIQSVLASIPIYYMSLFKI 63