BLASTX nr result
ID: Paeonia23_contig00030957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030957 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301464.2| cyclophilin family protein [Populus trichoca... 59 5e-07 >ref|XP_002301464.2| cyclophilin family protein [Populus trichocarpa] gi|550345320|gb|EEE80737.2| cyclophilin family protein [Populus trichocarpa] Length = 266 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/72 (47%), Positives = 43/72 (59%) Frame = +3 Query: 105 MASAVSMQMISLYCPVIQGNNYCQDVTSMCRPHMIPSIRNMRPRFTIAPTLTCAARALAS 284 MAS SMQM VIQG+ Y QD + RPH I +IRN R ++ PTL C RAL S Sbjct: 1 MASTSSMQMAHSPRLVIQGS-YEQDFLNTSRPHKISTIRNARGGYSQTPTLNCLGRALTS 59 Query: 285 TSQYSSYLPVLQ 320 S Y+S P+++ Sbjct: 60 RSHYASKFPIIR 71