BLASTX nr result
ID: Paeonia23_contig00030704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030704 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339494.1| PREDICTED: ubiquitin-related modifier 1 homo... 56 5e-06 >ref|XP_006339494.1| PREDICTED: ubiquitin-related modifier 1 homolog 1-like [Solanum tuberosum] Length = 99 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 178 CNSVKVHNVNVDVQDGEDKLTMKNLLSWVNT 270 C+SVK HN+NVD QDGE++LTMKNLLSWV T Sbjct: 15 CDSVKSHNINVDPQDGEEQLTMKNLLSWVRT 45