BLASTX nr result
ID: Paeonia23_contig00030666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030666 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208478.1| hypothetical protein PRUPE_ppa004180mg [Prun... 56 6e-06 >ref|XP_007208478.1| hypothetical protein PRUPE_ppa004180mg [Prunus persica] gi|462404120|gb|EMJ09677.1| hypothetical protein PRUPE_ppa004180mg [Prunus persica] Length = 525 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +3 Query: 81 LRRIISILNQCTASKDYFTEKNMVGEDEANAENVDRLLDCCCKFTK 218 LRRIIS+LNQ TASKD E M+G + N+DRLLDCCCK ++ Sbjct: 480 LRRIISLLNQWTASKDDDKENEMMGNRYEDDINIDRLLDCCCKHSE 525