BLASTX nr result
ID: Paeonia23_contig00030501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030501 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] 42 3e-07 >gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] Length = 1859 Score = 41.6 bits (96), Expect(2) = 3e-07 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = +3 Query: 375 FPTSLGEVPLRWWSSLPEASITCWEDLARTFTKQFVTSK 491 FPTSL E PL W+S LP SI ++ L FT Q+ TS+ Sbjct: 264 FPTSLREGPLGWFSDLPPNSIASFDALELKFTTQYATSR 302 Score = 38.5 bits (88), Expect(2) = 3e-07 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 274 LRMYDGSTDPTFHLMFYQHKITLYDEHEGFMCKNFP 381 + +YDGSTDP HL ++ ++TLY CK FP Sbjct: 230 INLYDGSTDPDEHLNIFRTQMTLYTTDRTVWCKVFP 265