BLASTX nr result
ID: Paeonia23_contig00029803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029803 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72141.1| hypothetical protein VITISV_017108 [Vitis vinifera] 59 4e-07 >emb|CAN72141.1| hypothetical protein VITISV_017108 [Vitis vinifera] Length = 1416 Score = 58.5 bits (140), Expect(2) = 4e-07 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -3 Query: 218 ISLADDTFSRVHNKGNVHLSSDITLNYVLNAPHLALNLLFVNRLARDFNCCFL 60 + +AD FS + KG + +S I L +VL+ P L NLLFV++L+RDFNCC + Sbjct: 310 VQIADGNFSPIAGKGLIKISEGIDLKFVLHVPKLTCNLLFVSKLSRDFNCCVI 362 Score = 21.2 bits (43), Expect(2) = 4e-07 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 301 ILDSGANDHIVS 266 I+DSGA+DH+ + Sbjct: 282 IIDSGASDHMTN 293