BLASTX nr result
ID: Paeonia23_contig00029755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029755 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308763.1| hypothetical protein POPTR_0006s00750g [Popu... 64 2e-08 gb|ABK93716.1| unknown [Populus trichocarpa] 61 2e-07 ref|XP_002323122.1| hypothetical protein POPTR_0016s00800g [Popu... 59 5e-07 ref|XP_007212228.1| hypothetical protein PRUPE_ppa013362mg [Prun... 59 9e-07 >ref|XP_002308763.1| hypothetical protein POPTR_0006s00750g [Populus trichocarpa] gi|222854739|gb|EEE92286.1| hypothetical protein POPTR_0006s00750g [Populus trichocarpa] Length = 129 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 157 MQSIRNSLLRHLRVSCSLEKRLFTEDDNVLKRLGRQMCTLISNSPDQIMDRV 2 MQSIRNS+L H+R+ S E+ LF + NV K+L RQMCT + SPD+IMDRV Sbjct: 1 MQSIRNSILSHIRLRGSAEQFLFAQRGNVFKQLHRQMCTSVGTSPDKIMDRV 52 >gb|ABK93716.1| unknown [Populus trichocarpa] Length = 129 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -3 Query: 157 MQSIRNSLLRHLRVSCSLEKRLFTEDDNVLKRLGRQMCTLISNSPDQIMDRV 2 MQS+RNS+L H+ + S E+ LF + NV K+L QMCT NSPDQIMDRV Sbjct: 1 MQSVRNSILSHMGLRGSAEQLLFAQRGNVFKQLRWQMCTSAGNSPDQIMDRV 52 >ref|XP_002323122.1| hypothetical protein POPTR_0016s00800g [Populus trichocarpa] gi|566207976|ref|XP_006373588.1| hypothetical protein POPTR_0016s00800g [Populus trichocarpa] gi|222867752|gb|EEF04883.1| hypothetical protein POPTR_0016s00800g [Populus trichocarpa] gi|550320508|gb|ERP51385.1| hypothetical protein POPTR_0016s00800g [Populus trichocarpa] Length = 129 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -3 Query: 157 MQSIRNSLLRHLRVSCSLEKRLFTEDDNVLKRLGRQMCTLISNSPDQIMDRV 2 MQS+RNS+L H+ + S E+ LF + NV K+L QMCT NSPD+IMDRV Sbjct: 1 MQSVRNSILSHMGLRGSAEQLLFAQRGNVFKQLRWQMCTSAGNSPDRIMDRV 52 >ref|XP_007212228.1| hypothetical protein PRUPE_ppa013362mg [Prunus persica] gi|462408093|gb|EMJ13427.1| hypothetical protein PRUPE_ppa013362mg [Prunus persica] Length = 127 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/53 (62%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -3 Query: 157 MQSIRNSLLRHLRVSCSLEKRLFTEDDNVLKRLGRQMCTLI-SNSPDQIMDRV 2 MQSIRNS+L H+RV S EK L TE NVLK L R MC + S DQIMDRV Sbjct: 1 MQSIRNSILWHVRVGSSAEKWLLTERGNVLKSLSRHMCAATGTTSTDQIMDRV 53