BLASTX nr result
ID: Paeonia23_contig00029635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029635 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007316602.1| hypothetical protein SERLADRAFT_463490 [Serp... 56 4e-06 >ref|XP_007316602.1| hypothetical protein SERLADRAFT_463490 [Serpula lacrymans var. lacrymans S7.9] gi|336364409|gb|EGN92768.1| hypothetical protein SERLA73DRAFT_190621 [Serpula lacrymans var. lacrymans S7.3] gi|336385282|gb|EGO26429.1| hypothetical protein SERLADRAFT_463490 [Serpula lacrymans var. lacrymans S7.9] Length = 280 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 348 WELEAYTDLCLRAEPLTLAEGKLLGLDRVIRLVQVREEARAGGR 217 W L AYT+LC RAEPL++ EG LGLD IR+ Q+RE+ R G R Sbjct: 162 WALSAYTELCERAEPLSMDEGHALGLDTTIRVSQLREKLRCGRR 205