BLASTX nr result
ID: Paeonia23_contig00029619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029619 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29927.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002282225.1| PREDICTED: GATA transcription factor 9-like ... 59 9e-07 emb|CAN83570.1| hypothetical protein VITISV_041707 [Vitis vinifera] 59 9e-07 ref|XP_007030701.1| GATA transcription factor 9, putative [Theob... 58 2e-06 >emb|CBI29927.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 145 MDFCRNVSVSGGLPSEYPSEQVLSPPCSKLGGLS-GSLDDMFSGQNT 282 MDF R VSVSG EYP EQV S CSKLGGLS GSLDD+FS QNT Sbjct: 1 MDFYREVSVSG----EYPQEQVPSTVCSKLGGLSAGSLDDLFSTQNT 43 >ref|XP_002282225.1| PREDICTED: GATA transcription factor 9-like [Vitis vinifera] Length = 299 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 145 MDFCRNVSVSGGLPSEYPSEQVLSPPCSKLGGLS-GSLDDMFSGQNT 282 MDF R VSVSG EYP EQV S CSKLGGLS GSLDD+FS QNT Sbjct: 1 MDFYREVSVSG----EYPQEQVPSTVCSKLGGLSAGSLDDLFSTQNT 43 >emb|CAN83570.1| hypothetical protein VITISV_041707 [Vitis vinifera] Length = 620 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 145 MDFCRNVSVSGGLPSEYPSEQVLSPPCSKLGGLS-GSLDDMFSGQNT 282 MDF R VSVSG EYP EQV S CSKLGGLS GSLDD+FS QNT Sbjct: 322 MDFYREVSVSG----EYPQEQVPSTVCSKLGGLSAGSLDDLFSTQNT 364 >ref|XP_007030701.1| GATA transcription factor 9, putative [Theobroma cacao] gi|508719306|gb|EOY11203.1| GATA transcription factor 9, putative [Theobroma cacao] Length = 302 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%) Frame = +1 Query: 145 MDFCRNVSVSGGLPSEYPSEQVLSPPCSKLG---GLSGSLDDMFSGQNT 282 MDFC+NVSVSG EY EQVLS PCSKLG +G+LDD+F QNT Sbjct: 1 MDFCQNVSVSG----EYHQEQVLSSPCSKLGATLATTGTLDDLFPAQNT 45