BLASTX nr result
ID: Paeonia23_contig00029527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029527 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006290323.1| hypothetical protein CARUB_v10016785mg [Caps... 57 3e-06 tpg|DAA62448.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea m... 57 3e-06 gb|EXC11714.1| Alpha-1,4-galacturonosyltransferase 1 [Morus nota... 56 5e-06 ref|XP_007134929.1| hypothetical protein PHAVU_010G087600g [Phas... 56 5e-06 ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galactu... 56 5e-06 ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao... 56 5e-06 ref|XP_004510897.1| PREDICTED: polygalacturonate 4-alpha-galactu... 56 5e-06 tpg|DAA40616.1| TPA: hypothetical protein ZEAMMB73_629807 [Zea m... 56 5e-06 >ref|XP_006290323.1| hypothetical protein CARUB_v10016785mg [Capsella rubella] gi|565464720|ref|XP_006290324.1| hypothetical protein CARUB_v10016785mg [Capsella rubella] gi|482559030|gb|EOA23221.1| hypothetical protein CARUB_v10016785mg [Capsella rubella] gi|482559031|gb|EOA23222.1| hypothetical protein CARUB_v10016785mg [Capsella rubella] Length = 591 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNMVSFLMT 91 MN+FDLKEWKK++ITGIYHKWQNMV +T Sbjct: 559 MNMFDLKEWKKRDITGIYHKWQNMVIISLT 588 >tpg|DAA62448.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays] Length = 615 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNMV 76 MNIFDL+EWKKK+ITGIYHKWQNMV Sbjct: 569 MNIFDLREWKKKDITGIYHKWQNMV 593 >gb|EXC11714.1| Alpha-1,4-galacturonosyltransferase 1 [Morus notabilis] Length = 678 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 564 MNIFDLKEWKKKDITGIYHKWQNM 587 >ref|XP_007134929.1| hypothetical protein PHAVU_010G087600g [Phaseolus vulgaris] gi|561007974|gb|ESW06923.1| hypothetical protein PHAVU_010G087600g [Phaseolus vulgaris] Length = 671 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 557 MNIFDLKEWKKKDITGIYHKWQNM 580 >ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like [Setaria italica] Length = 682 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 568 MNIFDLKEWKKKDITGIYHKWQNM 591 >ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao] gi|508704246|gb|EOX96142.1| Galacturonosyltransferase 1 [Theobroma cacao] Length = 676 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 562 MNIFDLKEWKKKDITGIYHKWQNM 585 >ref|XP_004510897.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like isoform X1 [Cicer arietinum] gi|502157758|ref|XP_004510898.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like isoform X2 [Cicer arietinum] gi|502157761|ref|XP_004510899.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like isoform X3 [Cicer arietinum] Length = 671 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 557 MNIFDLKEWKKKDITGIYHKWQNM 580 >tpg|DAA40616.1| TPA: hypothetical protein ZEAMMB73_629807 [Zea mays] Length = 684 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 MNIFDLKEWKKKNITGIYHKWQNM 73 MNIFDLKEWKKK+ITGIYHKWQNM Sbjct: 570 MNIFDLKEWKKKDITGIYHKWQNM 593