BLASTX nr result
ID: Paeonia23_contig00029435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029435 (1313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 64 8e-11 ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 58 2e-10 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] gi|56806642|dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 63.5 bits (153), Expect(2) = 8e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 711 FSVLCSNQMSYLNHFPKVSFLHRIAPYLTT 800 FSVLCSNQ+SYLNHFPKV FLHRIAPYLTT Sbjct: 87 FSVLCSNQLSYLNHFPKVCFLHRIAPYLTT 116 Score = 31.6 bits (70), Expect(2) = 8e-11 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 659 LWTPRPFRSGFKPLTQGF 712 +WT R RSGF+PLTQGF Sbjct: 70 VWTFRLLRSGFEPLTQGF 87 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435128|ref|YP_004222346.1| hypothetical protein BevumaM_p112 [Beta vulgaris subsp. maritima] gi|346683219|ref|YP_004842151.1| hypothetical protein BemaM_p107 [Beta macrocarpa] gi|9087354|dbj|BAA99498.1| orf110b [Beta vulgaris subsp. vulgaris] gi|317905682|emb|CBJ14076.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439861|emb|CBJ17566.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148051|emb|CBJ20714.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500137|emb|CBX24956.1| hypothetical protein [Beta macrocarpa] gi|384939116|emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 58.2 bits (139), Expect(2) = 2e-10 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 711 FSVLCSNQMSYLNHFPKVSFLHRIAPY 791 FSVLCSNQ+SYLNHFPKV FLHRIAPY Sbjct: 57 FSVLCSNQLSYLNHFPKVCFLHRIAPY 83 Score = 35.4 bits (80), Expect(2) = 2e-10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 662 WTPRPFRSGFKPLTQGF 712 WT RP RSGF+PLTQGF Sbjct: 41 WTLRPLRSGFEPLTQGF 57