BLASTX nr result
ID: Paeonia23_contig00029353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029353 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214494.1| hypothetical protein PRUPE_ppa019693mg [Prun... 66 4e-09 >ref|XP_007214494.1| hypothetical protein PRUPE_ppa019693mg [Prunus persica] gi|462410359|gb|EMJ15693.1| hypothetical protein PRUPE_ppa019693mg [Prunus persica] Length = 368 Score = 66.2 bits (160), Expect = 4e-09 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 4/77 (5%) Frame = -1 Query: 221 MLKLLPWRRSTYQSLT--PNQKMSLLPRFLCQSVTEDTY--DPPFSPIIKTLNPRISNNK 54 MLKLLPWR S +++LT P + S L RFL S++ED Y DPPFSP+ K P+ NK Sbjct: 1 MLKLLPWRPSPHKTLTLDPAKPFSSLSRFLSHSLSEDQYEDDPPFSPVSKP--PKPKKNK 58 Query: 53 KPERTPDSLSDPNCPLK 3 + PD+ ++P PLK Sbjct: 59 TQNKDPDTKNEPTRPLK 75