BLASTX nr result
ID: Paeonia23_contig00029336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029336 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolo... 191 2e-46 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 190 2e-46 ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citr... 188 1e-45 ref|XP_002320775.1| signal recognition particle receptor family ... 187 2e-45 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 186 3e-45 ref|XP_007051904.1| Signal recognition particle receptor protein... 186 4e-45 ref|XP_007051903.1| Signal recognition particle receptor protein... 186 4e-45 ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prun... 186 4e-45 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 186 4e-45 ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolo... 185 7e-45 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 185 9e-45 ref|XP_004306830.1| PREDICTED: cell division protein FtsY homolo... 184 2e-44 ref|XP_006397776.1| hypothetical protein EUTSA_v10001508mg [Eutr... 184 2e-44 ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prun... 184 2e-44 ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [A... 183 3e-44 gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlise... 182 5e-44 ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolo... 182 8e-44 ref|XP_006294469.1| hypothetical protein CARUB_v10023482mg [Caps... 181 1e-43 gb|AAD47910.1|AF120112_1 chloroplast SRP receptor homolog, alpha... 181 1e-43 ref|NP_001189754.1| cell division protein FtsY [Arabidopsis tha... 181 1e-43 >ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Vitis vinifera] gi|296089055|emb|CBI38758.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 191 bits (484), Expect = 2e-46 Identities = 95/101 (94%), Positives = 99/101 (98%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKVV GAPNEILLVLDGTTGLNMLPQAREFN++VGISGLILTKLDGSAR Sbjct: 267 MEELIACKKAVGKVVSGAPNEILLVLDGTTGLNMLPQAREFNEVVGISGLILTKLDGSAR 326 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 327 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEVFVNAIFS 367 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 190 bits (483), Expect = 2e-46 Identities = 94/100 (94%), Positives = 98/100 (98%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKVVPGAPNEILLVLDG TGLNMLPQAREFN++VGI+GLILTKLDGSAR Sbjct: 262 MEELIACKKAIGKVVPGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSAR 321 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF Sbjct: 322 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 361 >ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|567905284|ref|XP_006445130.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|568875898|ref|XP_006491027.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547391|gb|ESR58369.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|557547392|gb|ESR58370.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] Length = 372 Score = 188 bits (477), Expect = 1e-45 Identities = 93/101 (92%), Positives = 98/101 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEEL+ACKKA+GKVV GAPNEILLVLDGTTGLNMLPQAREFN +VGI+GLILTKLDGSAR Sbjct: 272 MEELVACKKAVGKVVNGAPNEILLVLDGTTGLNMLPQAREFNDVVGITGLILTKLDGSAR 331 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 332 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 372 >ref|XP_002320775.1| signal recognition particle receptor family protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| signal recognition particle receptor family protein [Populus trichocarpa] Length = 365 Score = 187 bits (475), Expect = 2e-45 Identities = 92/101 (91%), Positives = 98/101 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GK+V GAPNEILLVLDGTTGLNMLPQAREFN++VGI+G ILTKLDGSAR Sbjct: 265 MEELIACKKAVGKIVRGAPNEILLVLDGTTGLNMLPQAREFNEVVGITGFILTKLDGSAR 324 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 325 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 365 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 186 bits (473), Expect = 3e-45 Identities = 90/100 (90%), Positives = 98/100 (98%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELI+CKK++ KV+PGAPNEILLVLDGTTGLNMLPQAREFN +VG++GLILTKLDGSAR Sbjct: 272 MEELISCKKSVAKVIPGAPNEILLVLDGTTGLNMLPQAREFNDVVGVTGLILTKLDGSAR 331 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE+FVNAIF Sbjct: 332 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 186 bits (472), Expect = 4e-45 Identities = 90/100 (90%), Positives = 97/100 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKV+PGAPNEILLVLDG TGLNMLPQAREFN++VGI+G ILTKLDGSAR Sbjct: 265 MEELIACKKAVGKVIPGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGFILTKLDGSAR 324 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAE FVNAIF Sbjct: 325 GGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIF 364 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 186 bits (472), Expect = 4e-45 Identities = 90/100 (90%), Positives = 97/100 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKV+PGAPNEILLVLDG TGLNMLPQAREFN++VGI+G ILTKLDGSAR Sbjct: 345 MEELIACKKAVGKVIPGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGFILTKLDGSAR 404 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAE FVNAIF Sbjct: 405 GGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIF 444 >ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] gi|462414630|gb|EMJ19367.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] Length = 365 Score = 186 bits (472), Expect = 4e-45 Identities = 92/101 (91%), Positives = 98/101 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+ KV+PGAPNEIL VLDGTTGLNMLPQAREFN+IVGI+GLILTKLDGSAR Sbjct: 265 MEELIACKKAVSKVIPGAPNEILQVLDGTTGLNMLPQAREFNEIVGITGLILTKLDGSAR 324 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 325 GGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 365 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 186 bits (472), Expect = 4e-45 Identities = 90/100 (90%), Positives = 97/100 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELI+CKK++ KVVPGAPNEILLVLDGTTGLNMLPQAREFN +VG++GL+LTKLDGSAR Sbjct: 272 MEELISCKKSVAKVVPGAPNEILLVLDGTTGLNMLPQAREFNDVVGVTGLVLTKLDGSAR 331 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF Sbjct: 332 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cicer arietinum] Length = 365 Score = 185 bits (470), Expect = 7e-45 Identities = 91/100 (91%), Positives = 97/100 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELI+CKKA+ KVV GAPNEILLVLDGTTGLNMLPQAREFN++VG++GLILTKLDGSAR Sbjct: 265 MEELISCKKAVAKVVAGAPNEILLVLDGTTGLNMLPQAREFNEVVGVTGLILTKLDGSAR 324 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF Sbjct: 325 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 185 bits (469), Expect = 9e-45 Identities = 89/100 (89%), Positives = 97/100 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELI+CKK++ KV+PGAPNEILLVLDGTTGLNMLPQAREFN +VG++GLILTKLDGSAR Sbjct: 271 MEELISCKKSVAKVIPGAPNEILLVLDGTTGLNMLPQAREFNDVVGVTGLILTKLDGSAR 330 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDA+ FVNAIF Sbjct: 331 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDADAFVNAIF 370 >ref|XP_004306830.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 365 Score = 184 bits (467), Expect = 2e-44 Identities = 91/101 (90%), Positives = 98/101 (97%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKV+PG+PNEIL VLDGTTGLNMLPQAREFN+IVGI+GLILTKLDGSAR Sbjct: 265 MEELIACKKAVGKVMPGSPNEILQVLDGTTGLNMLPQAREFNEIVGITGLILTKLDGSAR 324 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKFVGVGE VEDLQPFDAE FVNAIF+ Sbjct: 325 GGCVVSVVNELGIPVKFVGVGESVEDLQPFDAEAFVNAIFS 365 >ref|XP_006397776.1| hypothetical protein EUTSA_v10001508mg [Eutrema salsugineum] gi|557098849|gb|ESQ39229.1| hypothetical protein EUTSA_v10001508mg [Eutrema salsugineum] Length = 366 Score = 184 bits (466), Expect = 2e-44 Identities = 91/101 (90%), Positives = 97/101 (96%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKVV GAPNEILLVLDG TGLNMLPQAREFN+IVGI+GLILTKLDGSAR Sbjct: 266 MEELIACKKAVGKVVSGAPNEILLVLDGNTGLNMLPQAREFNEIVGITGLILTKLDGSAR 325 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKF+GVGE VEDLQPFDAE FVNAIF+ Sbjct: 326 GGCVVSVVEELGIPVKFIGVGEAVEDLQPFDAEAFVNAIFS 366 >ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] gi|462416829|gb|EMJ21566.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] Length = 333 Score = 184 bits (466), Expect = 2e-44 Identities = 91/101 (90%), Positives = 97/101 (96%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+ KV+PGAPNEIL VLDGT GLNMLPQAREFN+IVGI+GLILTKLDGSAR Sbjct: 233 MEELIACKKAVSKVIPGAPNEILQVLDGTMGLNMLPQAREFNEIVGITGLILTKLDGSAR 292 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 293 GGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 333 >ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] gi|548861955|gb|ERN19320.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] Length = 402 Score = 183 bits (465), Expect = 3e-44 Identities = 88/101 (87%), Positives = 97/101 (96%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEEL ACK+A+ K++PGAPNE+LLVLDGTTGLNMLPQAREFN++VGI+GLILTKLDGSAR Sbjct: 302 MEELSACKRAISKLIPGAPNEVLLVLDGTTGLNMLPQAREFNEVVGITGLILTKLDGSAR 361 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCV SVVDELGIPVKFVGVGEGVEDLQPFDAE FVNAIF+ Sbjct: 362 GGCVASVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 402 >gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlisea aurea] Length = 330 Score = 182 bits (463), Expect = 5e-44 Identities = 90/100 (90%), Positives = 95/100 (95%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKVV GAPNEIL VLDGTTGLNMLPQAREFN +VG++GLILTKLDGSAR Sbjct: 230 MEELIACKKAIGKVVSGAPNEILQVLDGTTGLNMLPQAREFNDVVGVTGLILTKLDGSAR 289 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIF 302 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFD + FVNAIF Sbjct: 290 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDPQAFVNAIF 329 >ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] gi|449480150|ref|XP_004155813.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] Length = 368 Score = 182 bits (461), Expect = 8e-44 Identities = 89/101 (88%), Positives = 96/101 (95%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+ KV+PGAPNEIL VLDGTTGLNMLPQAREFN +VGI+GLILTKLDGSAR Sbjct: 268 MEELIACKKAVAKVIPGAPNEILQVLDGTTGLNMLPQAREFNDVVGITGLILTKLDGSAR 327 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVVDELGIPVKFVGVGEG+EDLQPFD E FV+AIF+ Sbjct: 328 GGCVVSVVDELGIPVKFVGVGEGLEDLQPFDPEAFVDAIFS 368 >ref|XP_006294469.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|565473494|ref|XP_006294470.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|482563177|gb|EOA27367.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|482563178|gb|EOA27368.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] Length = 366 Score = 181 bits (460), Expect = 1e-43 Identities = 89/101 (88%), Positives = 96/101 (95%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GKVV GAPNEILLVLDG TGLNMLPQAREFN++VGI+GLILTKLDGSAR Sbjct: 266 MEELIACKKAVGKVVSGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSAR 325 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKF+GVGE VEDLQPFD E FVNAIF+ Sbjct: 326 GGCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVNAIFS 366 >gb|AAD47910.1|AF120112_1 chloroplast SRP receptor homolog, alpha subunit CPFTSY [Arabidopsis thaliana] Length = 366 Score = 181 bits (459), Expect = 1e-43 Identities = 88/101 (87%), Positives = 96/101 (95%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GK+V GAPNEILLVLDG TGLNMLPQAREFN++VGI+GLILTKLDGSAR Sbjct: 266 MEELIACKKAVGKIVSGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSAR 325 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKF+GVGE VEDLQPFD E FVNAIF+ Sbjct: 326 GGCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVNAIFS 366 >ref|NP_001189754.1| cell division protein FtsY [Arabidopsis thaliana] gi|330255506|gb|AEC10600.1| signal recognition particle receptor protein [Arabidopsis thaliana] Length = 373 Score = 181 bits (459), Expect = 1e-43 Identities = 88/101 (87%), Positives = 96/101 (95%) Frame = +3 Query: 3 MEELIACKKAMGKVVPGAPNEILLVLDGTTGLNMLPQAREFNQIVGISGLILTKLDGSAR 182 MEELIACKKA+GK+V GAPNEILLVLDG TGLNMLPQAREFN++VGI+GLILTKLDGSAR Sbjct: 273 MEELIACKKAVGKIVSGAPNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSAR 332 Query: 183 GGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAETFVNAIFA 305 GGCVVSVV+ELGIPVKF+GVGE VEDLQPFD E FVNAIF+ Sbjct: 333 GGCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVNAIFS 373