BLASTX nr result
ID: Paeonia23_contig00029233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029233 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600212.1| hypothetical protein MTR_3g055560 [Medicago ... 60 4e-07 ref|XP_003622919.1| hypothetical protein MTR_7g058320 [Medicago ... 59 5e-07 ref|XP_003592213.1| hypothetical protein MTR_1g100160 [Medicago ... 59 5e-07 ref|XP_003614993.1| hypothetical protein MTR_5g062140 [Medicago ... 59 9e-07 ref|XP_003600952.1| hypothetical protein MTR_3g071380 [Medicago ... 59 9e-07 ref|XP_003614149.1| hypothetical protein MTR_5g045440 [Medicago ... 58 1e-06 ref|XP_003620991.1| Histone H4 [Medicago truncatula] gi|35549600... 58 1e-06 gb|ABN09786.1| Histone H4; Histone-fold [Medicago truncatula] 58 1e-06 ref|XP_003598300.1| hypothetical protein MTR_3g010070 [Medicago ... 58 2e-06 ref|XP_003622852.1| hypothetical protein MTR_7g055500 [Medicago ... 57 2e-06 ref|XP_003598739.1| Pre-mRNA-processing factor [Medicago truncat... 57 2e-06 ref|XP_003625646.1| hypothetical protein MTR_7g101400 [Medicago ... 57 3e-06 ref|XP_003599061.1| hypothetical protein MTR_3g027260 [Medicago ... 57 3e-06 ref|XP_003613024.1| hypothetical protein MTR_5g031820 [Medicago ... 56 4e-06 ref|XP_003605995.1| hypothetical protein MTR_4g050600 [Medicago ... 56 4e-06 ref|XP_003616601.1| hypothetical protein MTR_5g082240 [Medicago ... 56 6e-06 ref|XP_003605235.1| hypothetical protein MTR_4g026990 [Medicago ... 56 6e-06 ref|XP_003620586.1| hypothetical protein MTR_6g087240 [Medicago ... 55 8e-06 ref|XP_003589413.1| hypothetical protein MTR_1g023970 [Medicago ... 55 8e-06 ref|XP_003596392.1| hypothetical protein MTR_2g076760 [Medicago ... 55 8e-06 >ref|XP_003600212.1| hypothetical protein MTR_3g055560 [Medicago truncatula] gi|355489260|gb|AES70463.1| hypothetical protein MTR_3g055560 [Medicago truncatula] Length = 285 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 236 G Y ++LVD+D + Q ++++ GY F+V V YER P C C IGHTI CKK Sbjct: 101 GLYTRVLVDVDMSRQLFDSVIVEREGYAFYVSVQYERKPPFCSHCKFIGHTIQQCKK 157 >ref|XP_003622919.1| hypothetical protein MTR_7g058320 [Medicago truncatula] gi|355497934|gb|AES79137.1| hypothetical protein MTR_7g058320 [Medicago truncatula] Length = 266 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/57 (43%), Positives = 36/57 (63%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 236 GQY ++LVD+D +H +L+ Y F+++V YE LPD C C +IGH + CKK Sbjct: 124 GQYVRVLVDMDLSHTIRYKLLVERKWYAFFIEVDYENLPDYCSNCKAIGHYVEICKK 180 >ref|XP_003592213.1| hypothetical protein MTR_1g100160 [Medicago truncatula] gi|355481261|gb|AES62464.1| hypothetical protein MTR_1g100160 [Medicago truncatula] Length = 651 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/56 (42%), Positives = 39/56 (69%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+IL+D+D + + I++ G+ F+V+V YE+LP+ C+ C +IGH+I CK Sbjct: 42 GHYARILIDLDLSKRIFNEIMVEREGFSFYVEVQYEQLPEYCNNCATIGHSIGQCK 97 >ref|XP_003614993.1| hypothetical protein MTR_5g062140 [Medicago truncatula] gi|355516328|gb|AES97951.1| hypothetical protein MTR_5g062140 [Medicago truncatula] Length = 449 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/89 (34%), Positives = 46/89 (51%), Gaps = 9/89 (10%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANC----- 242 G YA+ILVD+D++ + I + GY F ++V YE LPD C C +IGH + C Sbjct: 132 GHYARILVDMDFSRKLFHEIEVERQGYSFTLEVAYEWLPDFCSHCQNIGHDVTACRWLYP 191 Query: 241 ----KKKEEQVVELSHEGPSGTINIVPFR 167 KK +EQ + + P+ VP + Sbjct: 192 RKETKKHKEQTAQGKKQVPANKDTWVPIK 220 >ref|XP_003600952.1| hypothetical protein MTR_3g071380 [Medicago truncatula] gi|355490000|gb|AES71203.1| hypothetical protein MTR_3g071380 [Medicago truncatula] Length = 477 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 GQYA++LVD+D N+L+ GY F+V++ YE LPD C C IGH + C+ Sbjct: 219 GQYARVLVDMDITKDLRYNVLVERKGYAFFVELEYENLPDYCVHCKKIGHDVEICR 274 >ref|XP_003614149.1| hypothetical protein MTR_5g045440 [Medicago truncatula] gi|355515484|gb|AES97107.1| hypothetical protein MTR_5g045440 [Medicago truncatula] Length = 720 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 11/91 (12%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANC----- 242 G YA+ILVD+D+ + I++ G+ F V+V YER+PD C C +IGH I+ C Sbjct: 207 GHYARILVDMDFTRKLFYEIVVEREGFAFPVEVVYERMPDFCTHCQNIGHHISVCRWIHP 266 Query: 241 -KKKE-----EQVVELSHEGPSGTINIVPFR 167 K+KE E+V + + P+ VP + Sbjct: 267 RKEKENNTEKEKVAQGKKQMPTQRTEWVPLK 297 >ref|XP_003620991.1| Histone H4 [Medicago truncatula] gi|355496006|gb|AES77209.1| Histone H4 [Medicago truncatula] Length = 351 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/74 (36%), Positives = 42/74 (56%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKKKEE 227 G YA+IL+D+D + N+L+ F+VK+ YE+ P C+ C I H+I NCKK + Sbjct: 129 GHYARILIDLDLSQPILNNLLVGREESAFFVKIEYEKQPLFCNNCKHIRHSIQNCKKIAQ 188 Query: 226 QVVELSHEGPSGTI 185 ++L E T+ Sbjct: 189 NSIDLFKENKENTV 202 >gb|ABN09786.1| Histone H4; Histone-fold [Medicago truncatula] Length = 289 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/74 (36%), Positives = 42/74 (56%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKKKEE 227 G YA+IL+D+D + N+L+ F+VK+ YE+ P C+ C I H+I NCKK + Sbjct: 86 GHYARILIDLDLSQPILNNLLVGREESAFFVKIEYEKQPLFCNNCKHIRHSIQNCKKIAQ 145 Query: 226 QVVELSHEGPSGTI 185 ++L E T+ Sbjct: 146 NSIDLFKENKENTV 159 >ref|XP_003598300.1| hypothetical protein MTR_3g010070 [Medicago truncatula] gi|355487348|gb|AES68551.1| hypothetical protein MTR_3g010070 [Medicago truncatula] Length = 474 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/57 (42%), Positives = 37/57 (64%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 236 G YA+ILVD+D++H+ I++ GY F V+V YE + D C C +IGH + C++ Sbjct: 192 GHYARILVDMDFSHKLFHEIIVEREGYAFTVEVAYEWMSDYCSHCQNIGHDVTACRR 248 >ref|XP_003622852.1| hypothetical protein MTR_7g055500 [Medicago truncatula] gi|355497867|gb|AES79070.1| hypothetical protein MTR_7g055500 [Medicago truncatula] Length = 506 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 236 G YA+ILVD+D++ + IL+ GY F ++V YE LPD C C ++GH ++ C++ Sbjct: 212 GHYARILVDMDFSRKLFHEILVEREGYAFTLEVAYEWLPDYCTHCQNVGHDVSACRQ 268 >ref|XP_003598739.1| Pre-mRNA-processing factor [Medicago truncatula] gi|355487787|gb|AES68990.1| Pre-mRNA-processing factor [Medicago truncatula] Length = 800 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKKKEE 227 G YA+ILVDID + + IL+ G+ F V+V YER P C C IGH + NCK Sbjct: 421 GHYARILVDIDLSKRDYDEILVEREGFAFKVEVQYERRPLFCHHCYVIGHNVMNCKWLNP 480 Query: 226 QVVELSHEG 200 + +++ G Sbjct: 481 EAAKVNGRG 489 >ref|XP_003625646.1| hypothetical protein MTR_7g101400 [Medicago truncatula] gi|355500661|gb|AES81864.1| hypothetical protein MTR_7g101400 [Medicago truncatula] Length = 459 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/56 (41%), Positives = 37/56 (66%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVDID++ + I++ G + V+V Y+R+PD C C ++GH + NC+ Sbjct: 190 GHYARILVDIDFSKRIFHEIIVEREGASYPVEVVYKRIPDFCSHCQTLGHDVTNCR 245 >ref|XP_003599061.1| hypothetical protein MTR_3g027260 [Medicago truncatula] gi|355488109|gb|AES69312.1| hypothetical protein MTR_3g027260 [Medicago truncatula] Length = 572 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVD+D+ + I++ G+ F V+V Y+R+PD C C +IGH I+ C+ Sbjct: 216 GHYARILVDMDFTRKLFYEIVVEREGFAFSVEVVYDRMPDFCTNCKNIGHHISVCR 271 >ref|XP_003613024.1| hypothetical protein MTR_5g031820 [Medicago truncatula] gi|355514359|gb|AES95982.1| hypothetical protein MTR_5g031820 [Medicago truncatula] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -1 Query: 412 NLGQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 + G YA+ILVDID + + +L+ G+ F V+V YER P C C SIGH I C+ Sbjct: 217 SFGHYARILVDIDLSKKAYDEVLVERDGFAFMVEVQYERRPLFCHHCYSIGHNITTCR 274 >ref|XP_003605995.1| hypothetical protein MTR_4g050600 [Medicago truncatula] gi|355507050|gb|AES88192.1| hypothetical protein MTR_4g050600 [Medicago truncatula] Length = 539 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -1 Query: 412 NLGQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 + G YA+ILVDID + + +L+ G+ F V+V YER P C C SIGH I C+ Sbjct: 77 SFGHYARILVDIDLSKKAYDEVLVERDGFPFMVEVQYERRPLFCHHCYSIGHNITTCR 134 >ref|XP_003616601.1| hypothetical protein MTR_5g082240 [Medicago truncatula] gi|355517936|gb|AES99559.1| hypothetical protein MTR_5g082240 [Medicago truncatula] Length = 623 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVDID + + +L+ G+ F V++ YER P C +C SIGH I C+ Sbjct: 193 GHYARILVDIDLSKKAYDEVLVERDGFAFMVEIQYERRPLFCHQCYSIGHNITTCR 248 >ref|XP_003605235.1| hypothetical protein MTR_4g026990 [Medicago truncatula] gi|355506290|gb|AES87432.1| hypothetical protein MTR_4g026990 [Medicago truncatula] Length = 332 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK---- 239 G YA ILVDID++ + I++ G + V+V YER+PD C C ++GH + +C+ Sbjct: 28 GHYACILVDIDFSKKIFHEIIVEREGASYPVEVVYERIPDFCSHCQTLGHDVTSCRWLYP 87 Query: 238 KKEE 227 KKE+ Sbjct: 88 KKED 91 >ref|XP_003620586.1| hypothetical protein MTR_6g087240 [Medicago truncatula] gi|357500705|ref|XP_003620641.1| hypothetical protein MTR_6g088090 [Medicago truncatula] gi|355495601|gb|AES76804.1| hypothetical protein MTR_6g087240 [Medicago truncatula] gi|355495656|gb|AES76859.1| hypothetical protein MTR_6g088090 [Medicago truncatula] Length = 679 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVDID + + +L+ G+ F V++ YER P C C SIGH I C+ Sbjct: 207 GHYARILVDIDLSKKAYDEVLVERDGFAFMVEIQYERRPLFCHHCYSIGHNITTCR 262 >ref|XP_003589413.1| hypothetical protein MTR_1g023970 [Medicago truncatula] gi|355478461|gb|AES59664.1| hypothetical protein MTR_1g023970 [Medicago truncatula] Length = 612 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVDID + + +L+ G+ F V++ YER P C C SIGH I C+ Sbjct: 207 GHYARILVDIDLSKKAYDEVLVERDGFAFMVEIQYERRPLFCHHCYSIGHNITTCR 262 >ref|XP_003596392.1| hypothetical protein MTR_2g076760 [Medicago truncatula] gi|355485440|gb|AES66643.1| hypothetical protein MTR_2g076760 [Medicago truncatula] Length = 513 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = -1 Query: 406 GQYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 239 G YA+ILVD+D+ + I + GY F V+V YE LPD C C +IGH + C+ Sbjct: 209 GHYARILVDMDFARKMFHEITVEREGYAFNVEVAYEWLPDFCSHCQNIGHDVTVCR 264