BLASTX nr result
ID: Paeonia23_contig00029002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00029002 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB64606.1| Oligopeptide transporter 1 [Morus notabilis] 60 3e-07 gb|EXB64605.1| Oligopeptide transporter 1 [Morus notabilis] 57 2e-06 ref|XP_002864417.1| ATOPT1 [Arabidopsis lyrata subsp. lyrata] gi... 57 3e-06 ref|NP_200404.1| oligopeptide transporter 1 [Arabidopsis thalian... 56 6e-06 >gb|EXB64606.1| Oligopeptide transporter 1 [Morus notabilis] Length = 749 Score = 60.1 bits (144), Expect = 3e-07 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -1 Query: 102 WQQMKTKLRDQYGDVHAKLLKKNYESAPHWWFFI 1 WQQ K LRD++GDVH +L+KKNYE+ P WWF++ Sbjct: 398 WQQTKATLRDKFGDVHTRLMKKNYEAVPDWWFYV 431 >gb|EXB64605.1| Oligopeptide transporter 1 [Morus notabilis] Length = 749 Score = 57.4 bits (137), Expect = 2e-06 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = -1 Query: 102 WQQMKTKLRDQYGDVHAKLLKKNYESAPHWWFFI 1 WQQ K LRD++ DVH +L+KKNYE+ P WWF++ Sbjct: 398 WQQTKATLRDEFRDVHTRLMKKNYEAVPDWWFYV 431 >ref|XP_002864417.1| ATOPT1 [Arabidopsis lyrata subsp. lyrata] gi|297310252|gb|EFH40676.1| ATOPT1 [Arabidopsis lyrata subsp. lyrata] Length = 755 Score = 57.0 bits (136), Expect = 3e-06 Identities = 19/34 (55%), Positives = 28/34 (82%) Frame = -1 Query: 102 WQQMKTKLRDQYGDVHAKLLKKNYESAPHWWFFI 1 W++ KT +D+YGDVH++L+KKNY+S P WWF + Sbjct: 405 WKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFIV 438 >ref|NP_200404.1| oligopeptide transporter 1 [Arabidopsis thaliana] gi|67460971|sp|Q9FG72.1|OPT1_ARATH RecName: Full=Oligopeptide transporter 1; Short=AtOPT1 gi|9758213|dbj|BAB08658.1| sexual differentiation process protein ISP4-like [Arabidopsis thaliana] gi|17979460|gb|AAL50067.1| AT5g55930/MYN21_4 [Arabidopsis thaliana] gi|28416487|gb|AAO42774.1| At5g55930/MYN21_4 [Arabidopsis thaliana] gi|332009317|gb|AED96700.1| oligopeptide transporter 1 [Arabidopsis thaliana] Length = 755 Score = 55.8 bits (133), Expect = 6e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -1 Query: 102 WQQMKTKLRDQYGDVHAKLLKKNYESAPHWWF 7 W++ KT +D+YGDVH++L+KKNY+S P WWF Sbjct: 405 WKKAKTATKDKYGDVHSRLMKKNYQSVPQWWF 436