BLASTX nr result
ID: Paeonia23_contig00026868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00026868 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038695.1| Disease resistance family protein / LRR fami... 55 1e-05 >ref|XP_007038695.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508775940|gb|EOY23196.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 966 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = +3 Query: 6 EKVWFYMVVIXXXXXXXXXXXXXXXXNKRWRFAYFQFVDQVKEWILLTIALNTARLKKQI 185 EK+WFY+V++ K WR AYF FVD+ K+W+L+ +AL A +K I Sbjct: 900 EKMWFYIVIMSGYATGFWGVVAALIFEKSWRHAYFLFVDKCKDWVLVLVALKMASVKNLI 959 Query: 186 NGD 194 G+ Sbjct: 960 KGN 962