BLASTX nr result
ID: Paeonia23_contig00026480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00026480 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007049625.1| Auxin-responsive family protein [Theobroma c... 58 2e-06 >ref|XP_007049625.1| Auxin-responsive family protein [Theobroma cacao] gi|508701886|gb|EOX93782.1| Auxin-responsive family protein [Theobroma cacao] Length = 398 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -1 Query: 267 TWIVVLKRKSS-STKPYDGYNNDQGRQQPLAI 175 TW+VVLKRKS STKPYDGYNN QGRQQPLA+ Sbjct: 367 TWVVVLKRKSGESTKPYDGYNNGQGRQQPLAM 398