BLASTX nr result
ID: Paeonia23_contig00026143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00026143 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298188.1| PREDICTED: F-box protein FBW2-like [Fragaria... 56 5e-06 >ref|XP_004298188.1| PREDICTED: F-box protein FBW2-like [Fragaria vesca subsp. vesca] Length = 295 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = -3 Query: 275 EEAEAITNFLPSLKYLSLSVYPVTKDNLKILLEGCRVLESLLIRNC-GFDDSEEVLKKMT 99 +EA AI N +P +K LSL+ + +D L ILL+GC+ L L ++C GFD+ ++ + KM Sbjct: 188 KEATAIVNLIPDIKLLSLNDAQIDRDYLIILLKGCKELVMLEAKDCIGFDEGDDEIAKMA 247 Query: 98 GHVKN 84 HVK+ Sbjct: 248 SHVKS 252