BLASTX nr result
ID: Paeonia23_contig00025932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00025932 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF96803.1| retrotransposon protein, putative, Ty1-copia subc... 52 2e-07 gb|AAU89218.1| integrase core domain containing protein [Oryza s... 52 2e-07 ref|XP_002467512.1| hypothetical protein SORBIDRAFT_01g029366 [S... 51 4e-07 ref|XP_002449567.1| hypothetical protein SORBIDRAFT_05g019135 [S... 50 1e-06 ref|XP_002446503.1| hypothetical protein SORBIDRAFT_06g017035 [S... 50 2e-06 emb|CAE01490.1| P0041A24.2 [Oryza sativa Japonica Group] 48 2e-06 ref|XP_002446279.1| hypothetical protein SORBIDRAFT_06g012571 [S... 48 4e-06 ref|XP_002467660.1| hypothetical protein SORBIDRAFT_01g031795 [S... 48 4e-06 ref|XP_002442483.1| hypothetical protein SORBIDRAFT_08g020705 [S... 47 5e-06 >gb|ABF96803.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza sativa Japonica Group] Length = 1469 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + ITL + DFKS+ AYNS + +VSRL LCG+KI D+D Sbjct: 146 AQQDWITLRFQDFKSVTAYNSALHKLVSRLSLCGQKITDKD 186 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 108 RK*STRTKIENTLFTFHPREISVQQEY 188 +K + + IE TL TFHP + +QQ+Y Sbjct: 180 QKITDKDMIEKTLSTFHPGNMVLQQQY 206 >gb|AAU89218.1| integrase core domain containing protein [Oryza sativa Japonica Group] Length = 1419 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + ITL + DFKS+ AYNS + +VSRL LCG+KI D+D Sbjct: 97 AQQDWITLRFQDFKSVTAYNSALHKLVSRLSLCGQKITDKD 137 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 108 RK*STRTKIENTLFTFHPREISVQQEY 188 +K + + IE TL TFHP + +QQ+Y Sbjct: 131 QKITDKDMIEKTLSTFHPGNMVLQQQY 157 >ref|XP_002467512.1| hypothetical protein SORBIDRAFT_01g029366 [Sorghum bicolor] gi|241921366|gb|EER94510.1| hypothetical protein SORBIDRAFT_01g029366 [Sorghum bicolor] Length = 294 Score = 51.2 bits (121), Expect(2) = 4e-07 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +2 Query: 2 VAKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 +A+ +RI L + DFKS+ AYNS + IV++L LCG+KI D D Sbjct: 70 IAQQDRINLRFQDFKSVAAYNSALHMIVTKLRLCGQKITDAD 111 Score = 28.5 bits (62), Expect(2) = 4e-07 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 113 IEKTLSTFHPGNIVLQQQY 131 >ref|XP_002449567.1| hypothetical protein SORBIDRAFT_05g019135 [Sorghum bicolor] gi|241935410|gb|EES08555.1| hypothetical protein SORBIDRAFT_05g019135 [Sorghum bicolor] Length = 309 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + I L + DFKS++AYNS + IVS+L LCG+KI D D Sbjct: 101 AQQDWINLRFQDFKSVVAYNSALHRIVSKLRLCGQKITDAD 141 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 143 IEKTLSTFHPGNIVLQQQY 161 >ref|XP_002446503.1| hypothetical protein SORBIDRAFT_06g017035 [Sorghum bicolor] gi|241937686|gb|EES10831.1| hypothetical protein SORBIDRAFT_06g017035 [Sorghum bicolor] Length = 324 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + I L + DFKS+ AYNS + IV++L LCG+KIID D Sbjct: 101 AQQDWINLRFQDFKSVAAYNSALHRIVTKLRLCGQKIIDAD 141 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 I+ TL TFHP I +QQ+Y Sbjct: 143 IKKTLSTFHPGNILIQQQY 161 >emb|CAE01490.1| P0041A24.2 [Oryza sativa Japonica Group] Length = 1376 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 20/41 (48%), Positives = 31/41 (75%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+++ ITL + D+KS+ AYNS + I+S+L LCG+KI D + Sbjct: 101 AQHDWITLRFQDYKSVAAYNSALHRIISQLRLCGQKITDAE 141 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 143 IEKTLSTFHPNNIVLQQQY 161 >ref|XP_002446279.1| hypothetical protein SORBIDRAFT_06g012571 [Sorghum bicolor] gi|241937462|gb|EES10607.1| hypothetical protein SORBIDRAFT_06g012571 [Sorghum bicolor] Length = 324 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + I L + DFKS+ AYNS + IV++L LCG+KI D D Sbjct: 101 AQQDWINLRFQDFKSVAAYNSALHRIVTKLRLCGQKITDAD 141 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 143 IEKTLSTFHPGNIVLQQQY 161 >ref|XP_002467660.1| hypothetical protein SORBIDRAFT_01g031795 [Sorghum bicolor] gi|241921514|gb|EER94658.1| hypothetical protein SORBIDRAFT_01g031795 [Sorghum bicolor] Length = 314 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + I L + DFKS+ AYNS + IV++L LCG+KI D D Sbjct: 91 AQQDWINLRFQDFKSVAAYNSALHRIVTKLRLCGQKITDAD 131 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 133 IEKTLSTFHPGNIVLQQQY 151 >ref|XP_002442483.1| hypothetical protein SORBIDRAFT_08g020705 [Sorghum bicolor] gi|241943176|gb|EES16321.1| hypothetical protein SORBIDRAFT_08g020705 [Sorghum bicolor] Length = 324 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 20/41 (48%), Positives = 29/41 (70%) Frame = +2 Query: 5 AKNERITLHYSDFKSILAYNSMMQNIVSRLILCGEKIIDED 127 A+ + I L + DFKS+ AYNS + +V++L LCG+KI D D Sbjct: 101 AQQDWINLRFQDFKSVAAYNSALHRVVTKLRLCGQKITDAD 141 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 132 IENTLFTFHPREISVQQEY 188 IE TL TFHP I +QQ+Y Sbjct: 143 IEKTLSTFHPGNIVLQQQY 161