BLASTX nr result
ID: Paeonia23_contig00025804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00025804 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83828.1| hypothetical protein VITISV_033034 [Vitis vinifera] 60 3e-15 ref|XP_004301938.1| PREDICTED: uncharacterized protein LOC101304... 62 8e-08 emb|CAN79264.1| hypothetical protein VITISV_034881 [Vitis vinifera] 62 8e-08 emb|CAN83411.1| hypothetical protein VITISV_037202 [Vitis vinifera] 62 8e-08 emb|CAN78061.1| hypothetical protein VITISV_003933 [Vitis vinifera] 62 8e-08 emb|CAN64689.1| hypothetical protein VITISV_030189 [Vitis vinifera] 62 8e-08 emb|CAN60706.1| hypothetical protein VITISV_043852 [Vitis vinifera] 62 8e-08 emb|CAN77974.1| hypothetical protein VITISV_006175 [Vitis vinifera] 62 8e-08 gb|AFP55573.1| retrotransposon protein [Rosa rugosa] 61 2e-07 emb|CAN61279.1| hypothetical protein VITISV_005751 [Vitis vinifera] 60 2e-07 emb|CAN72351.1| hypothetical protein VITISV_019853 [Vitis vinifera] 60 3e-07 ref|XP_004288697.1| PREDICTED: uncharacterized protein LOC101308... 60 4e-07 gb|AAK84483.1| putative copia-like polyprotein [Solanum lycopers... 59 5e-07 emb|CAN66208.1| hypothetical protein VITISV_035070 [Vitis vinifera] 59 5e-07 ref|XP_004237326.1| PREDICTED: uncharacterized protein LOC101252... 59 7e-07 emb|CAN71212.1| hypothetical protein VITISV_041614 [Vitis vinifera] 59 7e-07 emb|CAN71691.1| hypothetical protein VITISV_039294 [Vitis vinifera] 59 7e-07 ref|XP_004309897.1| PREDICTED: uncharacterized protein LOC101292... 59 9e-07 ref|XP_004244340.1| PREDICTED: uncharacterized protein LOC101262... 59 9e-07 gb|AFP55536.1| retrotransposon polyprotein [Rosa rugosa] 58 1e-06 >emb|CAN83828.1| hypothetical protein VITISV_033034 [Vitis vinifera] Length = 158 Score = 60.1 bits (144), Expect(2) = 3e-15 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLGIYV + SPSIIRYLEPLTGDV T Sbjct: 103 KMGPQRRLGIYVDFNSPSIIRYLEPLTGDVFT 134 Score = 47.4 bits (111), Expect(2) = 3e-15 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 259 DICGPIHPASGPFRYYMVLIDVSSKW 182 DICG IHP GPFRY+++LID S++W Sbjct: 58 DICGSIHPPCGPFRYFIILIDASTRW 83 >ref|XP_004301938.1| PREDICTED: uncharacterized protein LOC101304199 [Fragaria vesca subsp. vesca] Length = 569 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLGIYVGY SP+IIRYLEPLTGD+ T Sbjct: 418 KMGPQRRLGIYVGYESPTIIRYLEPLTGDLFT 449 >emb|CAN79264.1| hypothetical protein VITISV_034881 [Vitis vinifera] Length = 1360 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 577 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 608 >emb|CAN83411.1| hypothetical protein VITISV_037202 [Vitis vinifera] Length = 361 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 237 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 268 >emb|CAN78061.1| hypothetical protein VITISV_003933 [Vitis vinifera] Length = 259 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 172 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 203 >emb|CAN64689.1| hypothetical protein VITISV_030189 [Vitis vinifera] Length = 292 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 236 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 267 >emb|CAN60706.1| hypothetical protein VITISV_043852 [Vitis vinifera] Length = 805 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 106 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 137 >emb|CAN77974.1| hypothetical protein VITISV_006175 [Vitis vinifera] Length = 1501 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGDV T Sbjct: 711 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDVFT 742 >gb|AFP55573.1| retrotransposon protein [Rosa rugosa] Length = 2242 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLGIYVGY SP+IIRY+EPLTGD+ T Sbjct: 741 KMGPQRRLGIYVGYDSPTIIRYIEPLTGDLFT 772 >emb|CAN61279.1| hypothetical protein VITISV_005751 [Vitis vinifera] Length = 181 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLGIYVG+ SPSIIRYLEPLTG+V T Sbjct: 126 KMGPQRRLGIYVGFDSPSIIRYLEPLTGNVFT 157 >emb|CAN72351.1| hypothetical protein VITISV_019853 [Vitis vinifera] Length = 333 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLTGD T Sbjct: 236 KMGPQRRLGVYVGFDSPSIIRYLEPLTGDXFT 267 >ref|XP_004288697.1| PREDICTED: uncharacterized protein LOC101308809 [Fragaria vesca subsp. vesca] Length = 572 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLGIYVGY SP+IIRYLEPLT D+ T Sbjct: 295 KMGPQRRLGIYVGYESPTIIRYLEPLTSDLFT 326 >gb|AAK84483.1| putative copia-like polyprotein [Solanum lycopersicum] Length = 779 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDV 99 KMGPQRRLGIYVGY SPSII+YLEP+TGD+ Sbjct: 143 KMGPQRRLGIYVGYESPSIIKYLEPMTGDL 172 >emb|CAN66208.1| hypothetical protein VITISV_035070 [Vitis vinifera] Length = 1496 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSIIRYLEPLT DV T Sbjct: 713 KMGPQRRLGVYVGFDSPSIIRYLEPLTDDVFT 744 >ref|XP_004237326.1| PREDICTED: uncharacterized protein LOC101252478 [Solanum lycopersicum] Length = 753 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLTYV 87 KMGPQRRLGIYVG+ SPSIIRYLE LTGD+ T + Sbjct: 167 KMGPQRRLGIYVGFESPSIIRYLESLTGDLFTAI 200 >emb|CAN71212.1| hypothetical protein VITISV_041614 [Vitis vinifera] Length = 347 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG YVG+ SP IIRYLEPLTGDV T Sbjct: 236 KMGPQRRLGFYVGFDSPXIIRYLEPLTGDVFT 267 >emb|CAN71691.1| hypothetical protein VITISV_039294 [Vitis vinifera] Length = 337 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVG+ SPSII YLEPLTG+V T Sbjct: 213 KMGPQRRLGVYVGFDSPSIIXYLEPLTGBVFT 244 >ref|XP_004309897.1| PREDICTED: uncharacterized protein LOC101292366 [Fragaria vesca subsp. vesca] Length = 611 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMG QRRLGIYVGY SP+IIRYLEPLTGD+ T Sbjct: 65 KMGHQRRLGIYVGYESPTIIRYLEPLTGDLFT 96 >ref|XP_004244340.1| PREDICTED: uncharacterized protein LOC101262834 [Solanum lycopersicum] Length = 5610 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMG QRRLGIYVG+ SPSIIRYLEPLTGD+ T Sbjct: 2583 KMGSQRRLGIYVGFESPSIIRYLEPLTGDMFT 2614 >gb|AFP55536.1| retrotransposon polyprotein [Rosa rugosa] Length = 1508 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 188 KMGPQRRLGIYVGYYSPSIIRYLEPLTGDVLT 93 KMGPQRRLG+YVGY SP+IIRY+EPL GD+ T Sbjct: 684 KMGPQRRLGVYVGYDSPTIIRYIEPLIGDLFT 715