BLASTX nr result
ID: Paeonia23_contig00025662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00025662 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301585.1| PREDICTED: nuclear pore complex protein Nup9... 57 2e-06 ref|XP_006341370.1| PREDICTED: nuclear pore complex protein Nup9... 56 4e-06 ref|XP_004235924.1| PREDICTED: nuclear pore complex protein Nup9... 56 4e-06 >ref|XP_004301585.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Fragaria vesca subsp. vesca] Length = 1089 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +2 Query: 242 KHIKIWRLTSFMEDHKLVIEDWDLGARICISLYVTRSSL 358 KH IWRL + MEDHK IE+WDLGA I IS Y+TRSSL Sbjct: 944 KHSDIWRLATSMEDHKSEIENWDLGAGIYISFYLTRSSL 982 >ref|XP_006341370.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Solanum tuberosum] Length = 1033 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +2 Query: 242 KHIKIWRLTSFMEDHKLVIEDWDLGARICISLYVTRSSL 358 +H +IWRL + MEDHK IEDWDLGA I IS Y+ RSSL Sbjct: 889 EHSEIWRLAASMEDHKSEIEDWDLGAGIYISFYLLRSSL 927 >ref|XP_004235924.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Solanum lycopersicum] Length = 1012 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +2 Query: 242 KHIKIWRLTSFMEDHKLVIEDWDLGARICISLYVTRSSL 358 +H +IWRL + MEDHK IEDWDLGA I IS Y+ RSSL Sbjct: 868 EHSEIWRLAASMEDHKSEIEDWDLGAGIYISFYLLRSSL 906