BLASTX nr result
ID: Paeonia23_contig00025511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00025511 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29457.1| hypothetical protein L484_022128 [Morus notabilis] 63 5e-08 ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrio... 57 3e-06 >gb|EXB29457.1| hypothetical protein L484_022128 [Morus notabilis] Length = 71 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 12 INGFLEGYLRHFSANQKDWSCWMLLSAAIT 101 +NG L GYLRHFSANQKDWSCWMLLSAAIT Sbjct: 42 LNGLLGGYLRHFSANQKDWSCWMLLSAAIT 71 >ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] gi|403311598|gb|AFR34346.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] Length = 106 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 9/64 (14%) Frame = +2 Query: 53 KPEGLELLDVAQCCYNLTTKKLCIEXXXXXXXXXXXXXEGS--------KHQP-ILPRGG 205 +PEGLELLDVAQCCY LTTKKLC+E + HQP LPR G Sbjct: 42 QPEGLELLDVAQCCYKLTTKKLCVELQPLRVGHGATASDAPHHCGRRRLAHQPTFLPRRG 101 Query: 206 RSAS 217 RSA+ Sbjct: 102 RSAT 105