BLASTX nr result
ID: Paeonia23_contig00022167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00022167 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279984.2| PREDICTED: protein LUTEIN DEFICIENT 5, chlor... 67 3e-09 gb|EXC29901.1| Protein LUTEIN DEFICIENT 5 [Morus notabilis] 64 2e-08 ref|XP_002512609.1| cytochrome P450, putative [Ricinus communis]... 64 3e-08 ref|XP_007204988.1| hypothetical protein PRUPE_ppa003455mg [Prun... 63 4e-08 ref|XP_006376066.1| hypothetical protein POPTR_0013s08620g, part... 59 7e-07 gb|ADK60778.1| putative mitochondrial cytochrome P450 monooxygen... 58 1e-06 ref|XP_004302135.1| PREDICTED: protein LUTEIN DEFICIENT 5, chlor... 57 2e-06 >ref|XP_002279984.2| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Vitis vinifera] gi|297735311|emb|CBI17673.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVDASQG----DPQLGQKGEFTPARS 216 HTT GLKMTVTRRTKPPIVP LE MLKVD + G +P + QKGE +PA S Sbjct: 586 HTTQGLKMTVTRRTKPPIVPILETTMLKVDETGGVSKENPVISQKGEVSPAPS 638 >gb|EXC29901.1| Protein LUTEIN DEFICIENT 5 [Morus notabilis] Length = 613 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVDASQG----DPQLGQKGEFTPARS 216 HTT GLKMTV+RR KPPIVPTL PMLK+D+S G DP L + GE + A S Sbjct: 561 HTTEGLKMTVSRRVKPPIVPTLGTPMLKLDSSAGVSDNDPLLSETGEVSAAHS 613 >ref|XP_002512609.1| cytochrome P450, putative [Ricinus communis] gi|223548570|gb|EEF50061.1| cytochrome P450, putative [Ricinus communis] Length = 632 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVDA----SQGDPQLGQKGEFTPARS 216 HTT GL MTVTRR +PPI+P L+MP +K DA G+ QLGQKGE +PA S Sbjct: 580 HTTEGLTMTVTRRIQPPIMPMLDMPAMKGDAPGSVPSGESQLGQKGEVSPAHS 632 >ref|XP_007204988.1| hypothetical protein PRUPE_ppa003455mg [Prunus persica] gi|462400630|gb|EMJ06187.1| hypothetical protein PRUPE_ppa003455mg [Prunus persica] Length = 573 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 4/46 (8%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVD----ASQGDPQLGQKG 237 HTT GLKMTVTRR KPPIVPTLEMP +VD AS+GD +G+KG Sbjct: 527 HTTEGLKMTVTRRIKPPIVPTLEMPTFEVDTSVGASKGDSLVGKKG 572 >ref|XP_006376066.1| hypothetical protein POPTR_0013s08620g, partial [Populus trichocarpa] gi|550325302|gb|ERP53863.1| hypothetical protein POPTR_0013s08620g, partial [Populus trichocarpa] Length = 87 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVDAS----QGDPQLGQKGEFTPARS 216 HTT GLKMTVTRRT+PPI+P LE M +VD S +G QLG K E + A S Sbjct: 35 HTTEGLKMTVTRRTRPPIMPKLEKTMFEVDESTSGPEGGTQLGPKSEVSSANS 87 >gb|ADK60778.1| putative mitochondrial cytochrome P450 monooxygenase [Arachis diogoi] Length = 197 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVDASQGDPQLGQKGEFTPARS 216 HTT GLKMTVTRR KPPIVP+L+M +++D S QKGE A+S Sbjct: 149 HTTQGLKMTVTRRIKPPIVPSLQMSTMEIDPSMRKDDTSQKGEVYHAQS 197 >ref|XP_004302135.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 607 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = -3 Query: 362 HTTAGLKMTVTRRTKPPIVPTLEMPMLKVD----ASQGDPQLGQKG 237 HTT GL MTVTRR KPPIVPTLE+P D S+GD +GQKG Sbjct: 561 HTTEGLNMTVTRRIKPPIVPTLEVPAFDADTSVGVSKGDSLVGQKG 606