BLASTX nr result
ID: Paeonia23_contig00022103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00022103 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208171.1| hypothetical protein PRUPE_ppa001452mg [Prun... 56 1e-06 gb|EYU41833.1| hypothetical protein MIMGU_mgv1a001719mg [Mimulus... 58 1e-06 ref|XP_006381235.1| hypothetical protein POPTR_0006s09730g [Popu... 58 2e-06 ref|XP_006381234.1| DEFECTIVE IN EXINE FORMATION 1 family protei... 58 2e-06 ref|XP_006381233.1| hypothetical protein POPTR_0006s09730g [Popu... 58 2e-06 ref|XP_006576567.1| PREDICTED: uncharacterized protein LOC100805... 57 2e-06 ref|XP_002527860.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 gb|EPS71130.1| hypothetical protein M569_03629, partial [Genlise... 55 8e-06 >ref|XP_007208171.1| hypothetical protein PRUPE_ppa001452mg [Prunus persica] gi|462403813|gb|EMJ09370.1| hypothetical protein PRUPE_ppa001452mg [Prunus persica] Length = 825 Score = 56.2 bits (134), Expect(2) = 1e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLVSVTF*NQTLDVFVL 189 YVD++M DEEWTE Q +KL DYVN+D+HILCT V N + V+ Sbjct: 323 YVDESMWGDEEWTEEQHEKLEDYVNVDAHILCTPVIADIDNDGVSEMVV 371 Score = 21.9 bits (45), Expect(2) = 1e-06 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 2 FCNGDELANEYS 37 F N DELA+EYS Sbjct: 306 FRNSDELADEYS 317 >gb|EYU41833.1| hypothetical protein MIMGU_mgv1a001719mg [Mimulus guttatus] Length = 769 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLVSVTF*NQTLDVFVL 189 YVD+TM DEEWTEAQ +KL DYV+ID+H+LCT V N ++ V+ Sbjct: 280 YVDETMWGDEEWTEAQHEKLEDYVHIDAHVLCTPVIADIDNDGVNEMVV 328 >ref|XP_006381235.1| hypothetical protein POPTR_0006s09730g [Populus trichocarpa] gi|550335883|gb|ERP59032.1| hypothetical protein POPTR_0006s09730g [Populus trichocarpa] Length = 628 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLV 147 YVD++M DEEWTE Q +KL DYVNIDSHILCT V Sbjct: 125 YVDESMWGDEEWTEGQHEKLEDYVNIDSHILCTPV 159 >ref|XP_006381234.1| DEFECTIVE IN EXINE FORMATION 1 family protein [Populus trichocarpa] gi|550335882|gb|ERP59031.1| DEFECTIVE IN EXINE FORMATION 1 family protein [Populus trichocarpa] Length = 866 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLV 147 YVD++M DEEWTE Q +KL DYVNIDSHILCT V Sbjct: 363 YVDESMWGDEEWTEGQHEKLEDYVNIDSHILCTPV 397 >ref|XP_006381233.1| hypothetical protein POPTR_0006s09730g [Populus trichocarpa] gi|550335881|gb|ERP59030.1| hypothetical protein POPTR_0006s09730g [Populus trichocarpa] Length = 759 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLV 147 YVD++M DEEWTE Q +KL DYVNIDSHILCT V Sbjct: 256 YVDESMWGDEEWTEGQHEKLEDYVNIDSHILCTPV 290 >ref|XP_006576567.1| PREDICTED: uncharacterized protein LOC100805038 [Glycine max] Length = 886 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLV 147 YVD+TM DEEWTE + +KL DYVN+DSHILCT V Sbjct: 384 YVDETMWGDEEWTEVKHEKLEDYVNVDSHILCTPV 418 >ref|XP_002527860.1| conserved hypothetical protein [Ricinus communis] gi|223532711|gb|EEF34491.1| conserved hypothetical protein [Ricinus communis] Length = 868 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLV 147 YVD TM DEEWTE + +KL DYVNIDSHILCT V Sbjct: 365 YVDDTMWGDEEWTEEKHEKLEDYVNIDSHILCTPV 399 >gb|EPS71130.1| hypothetical protein M569_03629, partial [Genlisea aurea] Length = 413 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +1 Query: 43 YVDKTMLQDEEWTEAQPKKLHDYVNIDSHILCTLVSVTF*NQTLDVFVL 189 YVD+++ DEEWTEAQ +KL DYV ID+HILCT V N + V+ Sbjct: 270 YVDESLWGDEEWTEAQHEKLEDYVQIDAHILCTPVIADIDNDGISEMVV 318