BLASTX nr result
ID: Paeonia23_contig00021777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00021777 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211316.1| hypothetical protein PRUPE_ppa000192mg [Prun... 59 5e-07 >ref|XP_007211316.1| hypothetical protein PRUPE_ppa000192mg [Prunus persica] gi|462407051|gb|EMJ12515.1| hypothetical protein PRUPE_ppa000192mg [Prunus persica] Length = 1485 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -2 Query: 216 PTSSRNFLHCQ*F-VLFNTGLGFIYFRLEVWLIREKVIS*QTSLPLHGWMVLLFEVTTWL 40 P+ S+NF V+FN GL YF +W I EKV + QT LPLHGW+VLL + TWL Sbjct: 69 PSQSQNFSTVSIISVIFNAGLALAYFGFGIWTIIEKVNTCQTVLPLHGWLVLLIQGFTWL 128 Query: 39 ARA 31 A Sbjct: 129 LLA 131