BLASTX nr result
ID: Paeonia23_contig00021443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00021443 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citr... 63 5e-08 ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779... 56 4e-06 >ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] gi|557546496|gb|ESR57474.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] Length = 83 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -2 Query: 329 MGKFCCGESDDGFSIDLMGFLMVIVLALVFMLICTPPPRRGTVTVYRL 186 MGK C E + F +D MG LMV+VLAL M+IC PPPRR VT YR+ Sbjct: 35 MGKLICSEIEQTFGLDFMGLLMVLVLALTLMVICVPPPRRYMVTAYRV 82 >ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779627 [Setaria italica] Length = 49 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = -2 Query: 329 MGKFCCGESDDGFSIDLMGFLMVIVLALVFMLICTPPPRRGTVTVY 192 MGK CC + DD + +L+G L+ IVLAL+ +++CTPP RR + VY Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTIVLALLLLMMCTPPRRRRCIAVY 46