BLASTX nr result
ID: Paeonia23_contig00021148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00021148 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163722.1| hypothetical protein PHAVU_001G258700g [Phas... 56 6e-06 >ref|XP_007163722.1| hypothetical protein PHAVU_001G258700g [Phaseolus vulgaris] gi|561037186|gb|ESW35716.1| hypothetical protein PHAVU_001G258700g [Phaseolus vulgaris] Length = 377 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 3/35 (8%) Frame = -1 Query: 112 SEKPRPIDFYKEGSGGDMMIEVVSNGEL---PPHH 17 SEKPRPIDFYKE DMMIEVVSNG+L PPHH Sbjct: 4 SEKPRPIDFYKEEGARDMMIEVVSNGDLAPPPPHH 38