BLASTX nr result
ID: Paeonia23_contig00020907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020907 (832 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa] 57 6e-06 >gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa] Length = 832 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -3 Query: 113 LAQPSLSLAPIMASDRKIHLFDDVAKHNQTKDCWLII 3 ++Q SL+ +MASD K+H+F++VAKHNQTKDCWL+I Sbjct: 688 ISQSLFSLSLVMASDPKVHVFEEVAKHNQTKDCWLVI 724