BLASTX nr result
ID: Paeonia23_contig00020556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020556 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486994.1| PREDICTED: methylthioribose kinase-like [Cit... 62 1e-07 ref|XP_006422916.1| hypothetical protein CICLE_v10028518mg [Citr... 62 1e-07 ref|XP_006422915.1| hypothetical protein CICLE_v10028518mg [Citr... 62 1e-07 >ref|XP_006486994.1| PREDICTED: methylthioribose kinase-like [Citrus sinensis] Length = 419 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 404 RAECERQALEMAKLLLKGRREFHAITEVVSAIRKLHS 294 RA CERQALE+AKLLLK RR F AITEVVSAIRKLH+ Sbjct: 383 RATCERQALELAKLLLKERRNFQAITEVVSAIRKLHA 419 >ref|XP_006422916.1| hypothetical protein CICLE_v10028518mg [Citrus clementina] gi|557524850|gb|ESR36156.1| hypothetical protein CICLE_v10028518mg [Citrus clementina] Length = 419 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 404 RAECERQALEMAKLLLKGRREFHAITEVVSAIRKLHS 294 RA CERQALE+AKLLLK RR F AITEVVSAIRKLH+ Sbjct: 383 RATCERQALELAKLLLKERRNFQAITEVVSAIRKLHA 419 >ref|XP_006422915.1| hypothetical protein CICLE_v10028518mg [Citrus clementina] gi|557524849|gb|ESR36155.1| hypothetical protein CICLE_v10028518mg [Citrus clementina] Length = 344 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 404 RAECERQALEMAKLLLKGRREFHAITEVVSAIRKLHS 294 RA CERQALE+AKLLLK RR F AITEVVSAIRKLH+ Sbjct: 308 RATCERQALELAKLLLKERRNFQAITEVVSAIRKLHA 344