BLASTX nr result
ID: Paeonia23_contig00019316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019316 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prun... 62 1e-07 ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phas... 61 2e-07 gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis] 61 2e-07 sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor... 60 2e-07 ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Popu... 60 2e-07 ref|XP_002299888.1| actin-depolymerizing factor family protein [... 60 2e-07 ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, par... 60 4e-07 ref|XP_007027089.1| Actin depolymerizing factor 4 isoform 1 [The... 60 4e-07 gb|AFK48761.1| unknown [Lotus japonicus] 60 4e-07 ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycin... 60 4e-07 ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-lik... 59 5e-07 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis] 59 7e-07 gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas] 59 7e-07 ref|XP_002533101.1| actin depolymerizing factor, putative [Ricin... 59 7e-07 ref|XP_002314195.1| actin-depolymerizing factor family protein [... 59 7e-07 ref|XP_002316301.1| actin-depolymerizing factor family protein [... 59 7e-07 emb|CAL25339.1| actin-depolymerizing factor [Platanus x acerifolia] 59 7e-07 ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-lik... 59 9e-07 ref|XP_004240356.1| PREDICTED: actin-depolymerizing factor 2-lik... 59 9e-07 ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2-lik... 59 9e-07 >ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica] gi|462415035|gb|EMJ19772.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica] Length = 139 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +1 Query: 103 ELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 E A+SYEDFS+SLP ECRYAV +FD++T+E +S I+FIAWS Sbjct: 48 EPADSYEDFSASLPADECRYAVYDFDYVTEENCQKSRIIFIAWS 91 >ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris] gi|543176422|gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris] gi|561017647|gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris] Length = 139 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E AN YEDF++SLP ECRYAV +FDF+T+E +S I FIAWS Sbjct: 46 LGEPANGYEDFTASLPADECRYAVYDFDFVTEENCQKSKIFFIAWS 91 >gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis] Length = 139 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E NSYEDF++SLP ECRYAV +FD++T E +S IVFIAWS Sbjct: 46 LGEPTNSYEDFTASLPADECRYAVYDFDYVTDENCQKSRIVFIAWS 91 >sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2 gi|10441258|gb|AAG16974.1|AF183904_1 actin-depolymerizing factor 2 [Petunia x hybrida] gi|14906210|gb|AAK72616.1| actin-depolymerizing factor 2 [Petunia x hybrida] Length = 143 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E SYEDF++ LP ECRYAV +FDFMTKE +S I FIAWS Sbjct: 46 LGEPTESYEDFTAGLPADECRYAVYDFDFMTKENHQKSRIFFIAWS 91 >ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa] gi|566255780|ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa] gi|118481263|gb|ABK92579.1| unknown [Populus trichocarpa] gi|118489027|gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides] gi|222847145|gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa] gi|550308878|gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa] Length = 139 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E A SYEDF++SLP ECRYAV +FDF+T+E +S I FIAWS Sbjct: 46 LGEPAQSYEDFTASLPADECRYAVYDFDFVTEENVQKSRIFFIAWS 91 >ref|XP_002299888.1| actin-depolymerizing factor family protein [Populus trichocarpa] gi|118483144|gb|ABK93478.1| unknown [Populus trichocarpa] gi|118483210|gb|ABK93508.1| unknown [Populus trichocarpa] gi|118483701|gb|ABK93744.1| unknown [Populus trichocarpa] gi|118483749|gb|ABK93767.1| unknown [Populus trichocarpa] gi|222847146|gb|EEE84693.1| actin-depolymerizing factor family protein [Populus trichocarpa] Length = 139 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E A SYEDF++S+P ECRYAV +FDFMT E +S I FIAWS Sbjct: 46 LGEPAQSYEDFTASIPADECRYAVYDFDFMTAENVQKSRIFFIAWS 91 >ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao] gi|508715695|gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao] Length = 173 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E A SYEDF+ SLP ECRYAV +FDF+T E +S I FIAWS Sbjct: 80 LGEPAQSYEDFAKSLPADECRYAVYDFDFLTPENVQKSRIFFIAWS 125 >ref|XP_007027089.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao] gi|508715694|gb|EOY07591.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao] Length = 193 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E A SYEDF+ SLP ECRYAV +FDF+T E +S I FIAWS Sbjct: 100 LGEPAQSYEDFAKSLPADECRYAVYDFDFLTPENVQKSRIFFIAWS 145 >gb|AFK48761.1| unknown [Lotus japonicus] Length = 139 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E AN Y+DF++SLP ECRYAV +FDF+T+E +S I FIAWS Sbjct: 46 LGEPANGYDDFTASLPADECRYAVYDFDFVTEENCQKSRIFFIAWS 91 >ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max] gi|255627951|gb|ACU14320.1| unknown [Glycine max] Length = 139 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E AN Y+DF++SLP ECRYAV +FDF+T+E +S I FIAWS Sbjct: 46 LGEPANGYDDFAASLPADECRYAVYDFDFVTEENCQKSRIFFIAWS 91 >ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus] gi|449483886|ref|XP_004156722.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus] Length = 139 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 109 ANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 + SYEDF++SLP ECRYAV +FDF+T+E +S I+FIAWS Sbjct: 50 SESYEDFTASLPADECRYAVYDFDFVTEENCQKSRIIFIAWS 91 >gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis] Length = 159 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E SYEDF++SLP +ECRYAV ++DF+T+E +S I+FIAWS Sbjct: 66 LGEPTQSYEDFTASLPDNECRYAVYDYDFITEENVQKSKIIFIAWS 111 >gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas] Length = 139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 103 ELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 E A SYEDF++SLP ECRYAV +FDF+T E +S I FIAWS Sbjct: 48 EPARSYEDFTASLPTDECRYAVYDFDFVTAENCQKSKIFFIAWS 91 >ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis] gi|223527092|gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis] Length = 139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 103 ELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 E A SYEDF++SLP ECRYAV +FDF+T E +S I FIAWS Sbjct: 48 EPAQSYEDFTASLPADECRYAVYDFDFVTAENCQKSRIFFIAWS 91 >ref|XP_002314195.1| actin-depolymerizing factor family protein [Populus trichocarpa] gi|222850603|gb|EEE88150.1| actin-depolymerizing factor family protein [Populus trichocarpa] Length = 139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAW 231 L E A SYEDF++SLP ECRYAV +FDF+T+E +S I FIAW Sbjct: 46 LGEPAQSYEDFTASLPADECRYAVYDFDFVTEENVQKSRIFFIAW 90 >ref|XP_002316301.1| actin-depolymerizing factor family protein [Populus trichocarpa] gi|118486565|gb|ABK95121.1| unknown [Populus trichocarpa] gi|222865341|gb|EEF02472.1| actin-depolymerizing factor family protein [Populus trichocarpa] Length = 139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAW 231 L E A+SYE+FS+SLP ECRYAV +FD++T+E +S IVFIAW Sbjct: 46 LGEPADSYENFSASLPADECRYAVYDFDYVTEENCQKSRIVFIAW 90 >emb|CAL25339.1| actin-depolymerizing factor [Platanus x acerifolia] Length = 139 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 103 ELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 E SYEDFS+SLP ECRYAV +FDF+T E +S I FIAWS Sbjct: 48 EPTQSYEDFSASLPADECRYAVYDFDFVTAENVQKSRIFFIAWS 91 >ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum] Length = 143 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E SYEDF++ LP ECRYAV +FDFMT+E +S I FIAWS Sbjct: 46 LGEPTESYEDFAAGLPADECRYAVYDFDFMTEENCQKSRIFFIAWS 91 >ref|XP_004240356.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum lycopersicum] gi|565404747|ref|XP_006367788.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum] Length = 137 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAW 231 L E A SYEDF + LP ECRYAV +FDF+TKE+ +S I FIAW Sbjct: 44 LGEPAESYEDFCTHLPADECRYAVYDFDFLTKESVPKSRIFFIAW 88 >ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum lycopersicum] Length = 143 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 97 LYELANSYEDFSSSLPVHECRYAVSNFDFMTKETF*RSGIVFIAWS 234 L E SYEDF++ LP ECRYAV +FDFMT+E +S I FIAWS Sbjct: 46 LGEPTESYEDFAAGLPADECRYAVYDFDFMTEENCQKSRIFFIAWS 91