BLASTX nr result
ID: Paeonia23_contig00019295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019295 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [The... 56 5e-06 >ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] gi|590675884|ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] gi|590675888|ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] gi|508776820|gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] gi|508776821|gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] gi|508776822|gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao] Length = 280 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 292 TSEFTYNPNESNRHQQAAAPPAEERSRCTIM 200 TSEFTYNP+ESNR+QQ PAEERSRCTIM Sbjct: 250 TSEFTYNPSESNRYQQVTPQPAEERSRCTIM 280