BLASTX nr result
ID: Paeonia23_contig00019294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019294 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transpor... 56 5e-06 ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citr... 56 5e-06 ref|XP_006439661.1| hypothetical protein CICLE_v10019426mg [Citr... 56 5e-06 gb|ADH21397.1| nitrate transporter [Citrus trifoliata] 56 6e-06 >ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 588 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 261 GYFLLCAKWYKYKGSGGGTPEVVMEERPSEKSLV 160 G+FLLCAKWYKYKGSG G PEV ME+ EKS V Sbjct: 555 GFFLLCAKWYKYKGSGDGAPEVAMEKLNPEKSPV 588 >ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] gi|557541924|gb|ESR52902.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] Length = 588 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 261 GYFLLCAKWYKYKGSGGGTPEVVMEERPSEKSLV 160 G+FLLCAKWYKYKGSG G PEV ME+ EKS V Sbjct: 555 GFFLLCAKWYKYKGSGDGAPEVAMEKLNPEKSPV 588 >ref|XP_006439661.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] gi|557541923|gb|ESR52901.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] Length = 484 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 261 GYFLLCAKWYKYKGSGGGTPEVVMEERPSEKSLV 160 G+FLLCAKWYKYKGSG G PEV ME+ EKS V Sbjct: 451 GFFLLCAKWYKYKGSGDGAPEVAMEKLNPEKSPV 484 >gb|ADH21397.1| nitrate transporter [Citrus trifoliata] Length = 588 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 261 GYFLLCAKWYKYKGSGGGTPEVVMEERPSEKSLV 160 G+FLLCAKWYKYKGSG G PEV ME+ EKS V Sbjct: 555 GFFLLCAKWYKYKGSGDGAPEVAMEKVNPEKSPV 588