BLASTX nr result
ID: Paeonia23_contig00019228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019228 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220... 57 2e-06 >ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220238, partial [Cucumis sativus] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/77 (37%), Positives = 43/77 (55%) Frame = +3 Query: 12 WVMSN*PWYLFSKALLVLTNWQPFFDPLTFVLENQPLRFKLPHLPIGFWTFQNVERVISD 191 W++S PW+L K +L L W P P TFV ++ P+ KL +P+ WT + V S Sbjct: 18 WILSRGPWHLGGKPML-LRKWTPGIVPETFVFDSVPVWIKLGRIPLELWTDAGLVVVASA 76 Query: 192 VGKLLFVDYVTETKTKL 242 +GK L VD T+ + +L Sbjct: 77 IGKPLSVDLATKERCRL 93