BLASTX nr result
ID: Paeonia23_contig00019012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019012 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_007011706.1| Pentatricopeptide repeat-containing protein,... 73 5e-11 ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006450275.1| hypothetical protein CICLE_v10007356mg [Citr... 67 3e-09 ref|XP_002515418.1| pentatricopeptide repeat-containing protein,... 67 3e-09 ref|XP_006350217.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_004237112.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 gb|EXB86664.1| hypothetical protein L484_013194 [Morus notabilis] 65 1e-08 ref|XP_006845376.1| hypothetical protein AMTR_s00019p00039970 [A... 65 1e-08 ref|XP_002308709.2| hypothetical protein POPTR_0006s28060g [Popu... 64 2e-08 ref|XP_004157129.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 61 2e-07 ref|XP_004145582.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 gb|EYU21997.1| hypothetical protein MIMGU_mgv1a000826mg [Mimulus... 60 2e-07 ref|XP_003527773.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004293246.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 gb|EMT20043.1| Pentatricopeptide repeat-containing protein [Aegi... 59 9e-07 dbj|BAJ96987.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 9e-07 dbj|BAJ87260.1| predicted protein [Hordeum vulgare subsp. vulgar... 59 9e-07 dbj|BAJ89877.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 9e-07 ref|XP_006412544.1| hypothetical protein EUTSA_v10024264mg [Eutr... 57 3e-06 >ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vitis vinifera] gi|296082142|emb|CBI21147.3| unnamed protein product [Vitis vinifera] Length = 1113 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRG+S+SGNPDRAY +YKKMMVGGCRPN GTF QLPN Sbjct: 1074 LIRGHSMSGNPDRAYAVYKKMMVGGCRPNTGTFAQLPN 1111 >ref|XP_007011706.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508782069|gb|EOY29325.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 1112 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SGNPD AY +YK+MMVGGC PNRGTF QLPN Sbjct: 1073 LIRGYSVSGNPDHAYAVYKQMMVGGCSPNRGTFAQLPN 1110 >ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Citrus sinensis] Length = 1107 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGY SGNPD AY +Y+KMMVGGC PN GTF QLPN Sbjct: 1068 LIRGYGTSGNPDSAYAVYEKMMVGGCSPNPGTFAQLPN 1105 >ref|XP_006450275.1| hypothetical protein CICLE_v10007356mg [Citrus clementina] gi|557553501|gb|ESR63515.1| hypothetical protein CICLE_v10007356mg [Citrus clementina] Length = 973 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGY SGNPD AY +Y+KMMVGGC PN GTF QLPN Sbjct: 934 LIRGYGTSGNPDSAYAVYEKMMVGGCSPNPGTFAQLPN 971 >ref|XP_002515418.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545362|gb|EEF46867.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1113 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SGN D AY +YK+MMVGGC PN GTF QLPN Sbjct: 1076 LIRGYSMSGNSDSAYAVYKRMMVGGCSPNTGTFAQLPN 1113 >ref|XP_006350217.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Solanum tuberosum] Length = 1080 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS SG+PD AY IY+KMMVGGC PN GTF QLPN Sbjct: 1043 LIRGYSKSGDPDGAYAIYEKMMVGGCSPNSGTFAQLPN 1080 >ref|XP_004237112.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Solanum lycopersicum] Length = 1131 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS SG+PD AY IY+KMMVGGC PN GTF QLPN Sbjct: 1094 LIRGYSKSGDPDGAYAIYEKMMVGGCSPNSGTFAQLPN 1131 >gb|EXB86664.1| hypothetical protein L484_013194 [Morus notabilis] Length = 1098 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIR YS SGNPD AY +YKKMM+GGC PN TF QLPN Sbjct: 1059 LIRAYSASGNPDHAYAVYKKMMIGGCSPNVSTFAQLPN 1096 >ref|XP_006845376.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda] gi|548847948|gb|ERN07051.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda] Length = 1123 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIR YSI+GN D AY +YKKM+VGGC PN GTF QLPN Sbjct: 1084 LIRAYSIAGNTDHAYAVYKKMVVGGCEPNMGTFAQLPN 1121 >ref|XP_002308709.2| hypothetical protein POPTR_0006s28060g [Populus trichocarpa] gi|550337245|gb|EEE92232.2| hypothetical protein POPTR_0006s28060g [Populus trichocarpa] Length = 1115 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGY++SGN + AY IYKKMMVGGC PN GTF QLPN Sbjct: 1076 LIRGYTLSGNSELAYGIYKKMMVGGCDPNTGTFAQLPN 1113 >ref|XP_004157129.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Cucumis sativus] Length = 1113 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+S NP+ AY +YK MMV GC PN GT+ QLPN Sbjct: 1074 LIRGYSLSENPEHAYTVYKNMMVDGCNPNIGTYAQLPN 1111 >ref|XP_004145582.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Cucumis sativus] Length = 1113 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+S NP+ AY +YK MMV GC PN GT+ QLPN Sbjct: 1074 LIRGYSLSENPEHAYTVYKNMMVDGCNPNIGTYAQLPN 1111 >gb|EYU21997.1| hypothetical protein MIMGU_mgv1a000826mg [Mimulus guttatus] Length = 971 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIR +S++GNPD AY +Y++M+VGGC PN GTF QLPN Sbjct: 934 LIRAHSMAGNPDHAYDVYEEMVVGGCSPNNGTFAQLPN 971 >ref|XP_003527773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Glycine max] Length = 1113 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRG+S SGN DRA+ ++KKMM+ GC PN GTF QLPN Sbjct: 1074 LIRGHSKSGNKDRAFSVFKKMMIVGCSPNAGTFAQLPN 1111 >ref|XP_004293246.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1089 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIR YS SGN D AY +YK MMVGGC PN GT+ QLPN Sbjct: 1050 LIRLYSTSGNTDDAYAVYKNMMVGGCSPNVGTYAQLPN 1087 >gb|EMT20043.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 931 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SG+P+ A+ Y +M+VGGCRPN T+ QLPN Sbjct: 891 LIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 928 >dbj|BAJ96987.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1092 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SG+P+ A+ Y +M+VGGCRPN T+ QLPN Sbjct: 1052 LIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 1089 >dbj|BAJ87260.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326520816|dbj|BAJ92771.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1092 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SG+P+ A+ Y +M+VGGCRPN T+ QLPN Sbjct: 1052 LIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 1089 >dbj|BAJ89877.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 395 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SG+P+ A+ Y +M+VGGCRPN T+ QLPN Sbjct: 355 LIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 392 >ref|XP_006412544.1| hypothetical protein EUTSA_v10024264mg [Eutrema salsugineum] gi|557113714|gb|ESQ53997.1| hypothetical protein EUTSA_v10024264mg [Eutrema salsugineum] Length = 1118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -3 Query: 419 LIRGYSISGNPDRAYLIYKKMMVGGCRPNRGTFDQLPN 306 LIRGYS+SG P+ AY +Y+ M+ GG PN GT++QLPN Sbjct: 1079 LIRGYSLSGKPEHAYAVYQTMVTGGFSPNTGTYEQLPN 1116