BLASTX nr result
ID: Paeonia23_contig00018546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00018546 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004977275.1| PREDICTED: eukaryotic translation initiation... 58 2e-06 gb|EPS59429.1| hypothetical protein M569_15379, partial [Genlise... 57 2e-06 gb|EYU45867.1| hypothetical protein MIMGU_mgv1a005939mg [Mimulus... 57 3e-06 ref|XP_006644592.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006644591.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006597822.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006585503.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006585502.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006465998.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006357711.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006357391.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_006342964.1| PREDICTED: casein kinase I isoform delta-lik... 57 3e-06 ref|XP_007154635.1| hypothetical protein PHAVU_003G135100g [Phas... 57 3e-06 ref|XP_007138711.1| hypothetical protein PHAVU_009G230800g [Phas... 57 3e-06 gb|AHA84221.1| casein kinase I isoform delta-like protein [Phase... 57 3e-06 ref|XP_006451505.1| hypothetical protein CICLE_v10008160mg [Citr... 57 3e-06 ref|XP_006426585.1| hypothetical protein CICLE_v10025527mg [Citr... 57 3e-06 ref|XP_002299898.2| hypothetical protein POPTR_0001s20450g [Popu... 57 3e-06 ref|XP_006385411.1| hypothetical protein POPTR_0003s04170g [Popu... 57 3e-06 ref|XP_006853888.1| hypothetical protein AMTR_s00036p00147120 [A... 57 3e-06 >ref|XP_004977275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit I-like isoform X1 [Setaria italica] Length = 367 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +2 Query: 350 RVGLIFDLRDLAMEPRVGNKFRLGRKIGSGSFGEIYLG 463 R G +F MEPRVGN FRLGRKIGSGSFGEIYLG Sbjct: 318 RKGRVFSAVSGVMEPRVGNMFRLGRKIGSGSFGEIYLG 355 >gb|EPS59429.1| hypothetical protein M569_15379, partial [Genlisea aurea] Length = 78 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 383 AMEPRVGNKFRLGRKIGSGSFGEIYLG 463 +MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 SMEPRVGNKFRLGRKIGSGSFGEIYLG 27 >gb|EYU45867.1| hypothetical protein MIMGU_mgv1a005939mg [Mimulus guttatus] Length = 464 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006644592.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Oryza brachyantha] Length = 387 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006644591.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Oryza brachyantha] Length = 472 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006597822.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine max] Length = 312 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006585503.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine max] Length = 476 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006585502.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine max] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006465998.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis] Length = 474 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006357711.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum] Length = 472 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006357391.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum] Length = 467 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006342964.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum] Length = 471 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_007154635.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris] gi|561027989|gb|ESW26629.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris] Length = 455 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_007138711.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris] gi|561011798|gb|ESW10705.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris] Length = 456 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >gb|AHA84221.1| casein kinase I isoform delta-like protein [Phaseolus vulgaris] Length = 456 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006451505.1| hypothetical protein CICLE_v10008160mg [Citrus clementina] gi|568843157|ref|XP_006475484.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis] gi|557554731|gb|ESR64745.1| hypothetical protein CICLE_v10008160mg [Citrus clementina] Length = 477 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006426585.1| hypothetical protein CICLE_v10025527mg [Citrus clementina] gi|557528575|gb|ESR39825.1| hypothetical protein CICLE_v10025527mg [Citrus clementina] Length = 474 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_002299898.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa] gi|550347718|gb|EEE84703.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa] Length = 470 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006385411.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa] gi|550342369|gb|ERP63208.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa] Length = 464 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26 >ref|XP_006853888.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda] gi|548857556|gb|ERN15355.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda] Length = 476 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 386 MEPRVGNKFRLGRKIGSGSFGEIYLG 463 MEPRVGNKFRLGRKIGSGSFGEIYLG Sbjct: 1 MEPRVGNKFRLGRKIGSGSFGEIYLG 26