BLASTX nr result
ID: Paeonia23_contig00017562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00017562 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369892.1| calcium-activated outward-rectifying potassi... 118 1e-24 ref|XP_002317301.1| calcium-activated outward-rectifying potassi... 115 8e-24 ref|XP_006467521.1| PREDICTED: two-pore potassium channel 3-like... 105 7e-21 ref|XP_006449633.1| hypothetical protein CICLE_v10015235mg [Citr... 104 1e-20 ref|XP_007025167.1| Ca2+ activated outward rectifying K+ channel... 100 2e-19 ref|XP_007025166.1| Ca2+ activated outward rectifying K+ channel... 100 2e-19 gb|EXB86569.1| putative calcium-activated outward-rectifying pot... 100 4e-19 ref|XP_002272049.1| PREDICTED: probable calcium-activated outwar... 100 4e-19 emb|CBI30826.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 95 1e-17 ref|XP_006585018.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_006585017.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_006585016.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_006585015.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_006585014.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_003531079.1| PREDICTED: two-pore potassium channel 3-like... 94 2e-17 ref|XP_007158971.1| hypothetical protein PHAVU_002G197400g [Phas... 94 3e-17 ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like... 94 3e-17 ref|XP_004504709.1| PREDICTED: two-pore potassium channel 3-like... 93 3e-17 ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like... 93 3e-17 >ref|XP_006369892.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|550348861|gb|ERP66461.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 433 Score = 118 bits (295), Expect = 1e-24 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 4/83 (4%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL--LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSS 364 MEKEPLLPYLSP K++P P LFPLPE+ EISLPLP TPSELKDRLIFGP S+SP D S Sbjct: 1 MEKEPLLPYLSPRKRIPQPQPPLFPLPEDDEISLPLPLTPSELKDRLIFGPSSASPRDPS 60 Query: 365 PIVDALTLSLNSPRS--PSFAFS 427 P+++ALTLSLNSPRS P+ FS Sbjct: 61 PLLEALTLSLNSPRSSTPNLDFS 83 >ref|XP_002317301.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|222860366|gb|EEE97913.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 428 Score = 115 bits (287), Expect = 8e-24 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 2/88 (2%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSP--LLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSS 364 MEKEPLLPY+SP K+ P P LL PLPE+ EISLPLP TPSELKDRLIFGP SSSP D S Sbjct: 1 MEKEPLLPYVSPRKRTPQPPPLLCPLPEDDEISLPLPLTPSELKDRLIFGPSSSSPGDRS 60 Query: 365 PIVDALTLSLNSPRSPSFAFSDHGNHVD 448 P+V+ALT SLNSPR PS + D + +D Sbjct: 61 PLVEALTFSLNSPR-PSSSNQDFNSFLD 87 >ref|XP_006467521.1| PREDICTED: two-pore potassium channel 3-like [Citrus sinensis] Length = 447 Score = 105 bits (262), Expect = 7e-21 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 1/80 (1%) Frame = +2 Query: 191 MEKEPLLPYLSPIKK-VPSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSSP 367 MEKEPLL YLSP KK P P LFPLPE+GEIS+P+P TPSELKDRLIFGP +SP D+SP Sbjct: 1 MEKEPLLCYLSPRKKPTPPPPLFPLPEDGEISIPMPITPSELKDRLIFGPV-TSPKDASP 59 Query: 368 IVDALTLSLNSPRSPSFAFS 427 IVDALTLSL SP + + + S Sbjct: 60 IVDALTLSLASPTTSASSSS 79 >ref|XP_006449633.1| hypothetical protein CICLE_v10015235mg [Citrus clementina] gi|557552244|gb|ESR62873.1| hypothetical protein CICLE_v10015235mg [Citrus clementina] Length = 447 Score = 104 bits (260), Expect = 1e-20 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 1/80 (1%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL-LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSSP 367 MEKEPLL YLSP KK PL LFPLPE+GEIS+P+P TPSELKDRLIFGP +SP D+SP Sbjct: 1 MEKEPLLCYLSPRKKPTPPLPLFPLPEDGEISIPMPITPSELKDRLIFGPV-TSPRDASP 59 Query: 368 IVDALTLSLNSPRSPSFAFS 427 IVDALTLSL SP + + + S Sbjct: 60 IVDALTLSLPSPTTSASSSS 79 >ref|XP_007025167.1| Ca2+ activated outward rectifying K+ channel 6 isoform 2, partial [Theobroma cacao] gi|508780533|gb|EOY27789.1| Ca2+ activated outward rectifying K+ channel 6 isoform 2, partial [Theobroma cacao] Length = 527 Score = 100 bits (250), Expect = 2e-19 Identities = 56/92 (60%), Positives = 67/92 (72%), Gaps = 5/92 (5%) Frame = +2 Query: 173 VFRYTQMEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGP---C 340 + R ME +PLLPY+SPIKK+ P P LFPLPE E+S+PLP TPSE KDRLIFGP Sbjct: 83 LIRRFHMENDPLLPYVSPIKKITPPPPLFPLPENDEVSVPLPLTPSEFKDRLIFGPSPSS 142 Query: 341 SSSPHDSSPIVDALTLSLNSPR-SPSFAFSDH 433 SSSP + SPI DALT SLNS + S S +F ++ Sbjct: 143 SSSPIEPSPIFDALTSSLNSTKPSSSSSFQEN 174 >ref|XP_007025166.1| Ca2+ activated outward rectifying K+ channel 6 isoform 1 [Theobroma cacao] gi|508780532|gb|EOY27788.1| Ca2+ activated outward rectifying K+ channel 6 isoform 1 [Theobroma cacao] Length = 532 Score = 100 bits (250), Expect = 2e-19 Identities = 56/92 (60%), Positives = 67/92 (72%), Gaps = 5/92 (5%) Frame = +2 Query: 173 VFRYTQMEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGP---C 340 + R ME +PLLPY+SPIKK+ P P LFPLPE E+S+PLP TPSE KDRLIFGP Sbjct: 91 LIRRFHMENDPLLPYVSPIKKITPPPPLFPLPENDEVSVPLPLTPSEFKDRLIFGPSPSS 150 Query: 341 SSSPHDSSPIVDALTLSLNSPR-SPSFAFSDH 433 SSSP + SPI DALT SLNS + S S +F ++ Sbjct: 151 SSSPIEPSPIFDALTSSLNSTKPSSSSSFQEN 182 >gb|EXB86569.1| putative calcium-activated outward-rectifying potassium channel 6 [Morus notabilis] Length = 436 Score = 99.8 bits (247), Expect = 4e-19 Identities = 59/82 (71%), Positives = 64/82 (78%), Gaps = 2/82 (2%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPS--PLLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSS 364 ME EPLLPYLSP +K P P LFPLPE EI+LPL TPSELKDRLIFGP SSSP +SS Sbjct: 1 METEPLLPYLSPRRKPPPLPPQLFPLPEHDEITLPL--TPSELKDRLIFGP-SSSPQESS 57 Query: 365 PIVDALTLSLNSPRSPSFAFSD 430 PIVDALTLSL+S S S + SD Sbjct: 58 PIVDALTLSLSSKPSSSSSPSD 79 >ref|XP_002272049.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Vitis vinifera] Length = 509 Score = 99.8 bits (247), Expect = 4e-19 Identities = 55/78 (70%), Positives = 65/78 (83%), Gaps = 1/78 (1%) Frame = +2 Query: 185 TQMEKEPLLPYLSPIKKVPSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSS 364 T+M+ EPLLPYLSP K PSPL FPLPEE E++LPL TPSE KDRLIFGP SSSP DSS Sbjct: 87 TKMD-EPLLPYLSPRKSRPSPL-FPLPEEDEVALPL--TPSEFKDRLIFGPSSSSPSDSS 142 Query: 365 P-IVDALTLSLNSPRSPS 415 P ++DALTL++NSP++ S Sbjct: 143 PLLIDALTLTINSPKTSS 160 >emb|CBI30826.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 99.4 bits (246), Expect = 5e-19 Identities = 53/73 (72%), Positives = 61/73 (83%), Gaps = 1/73 (1%) Frame = +2 Query: 200 EPLLPYLSPIKKVPSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSSP-IVD 376 EPLLPYLSP K PSPL FPLPEE E++LPL TPSE KDRLIFGP SSSP DSSP ++D Sbjct: 3 EPLLPYLSPRKSRPSPL-FPLPEEDEVALPL--TPSEFKDRLIFGPSSSSPSDSSPLLID 59 Query: 377 ALTLSLNSPRSPS 415 ALTL++NSP++ S Sbjct: 60 ALTLTINSPKTSS 72 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 94.7 bits (234), Expect = 1e-17 Identities = 52/91 (57%), Positives = 64/91 (70%), Gaps = 7/91 (7%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPS---PLLFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDS 361 ME +PLLPY SP K+ P P+L PLPE+ E+SLPL +PSELK+RLIFGP S SP+DS Sbjct: 1 MENDPLLPYHSPRKRTPPQLPPILCPLPEDDEVSLPLSISPSELKERLIFGP-SPSPNDS 59 Query: 362 SPIVDALTLSLNSPR----SPSFAFSDHGNH 442 +P+ +ALT SLNSPR + F F D H Sbjct: 60 TPVFEALTHSLNSPRPSCSNQEFNFHDSPRH 90 >ref|XP_006585018.1| PREDICTED: two-pore potassium channel 3-like isoform X6 [Glycine max] Length = 398 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_006585017.1| PREDICTED: two-pore potassium channel 3-like isoform X5 [Glycine max] Length = 405 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_006585016.1| PREDICTED: two-pore potassium channel 3-like isoform X4 [Glycine max] Length = 417 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_006585015.1| PREDICTED: two-pore potassium channel 3-like isoform X3 [Glycine max] Length = 445 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_006585014.1| PREDICTED: two-pore potassium channel 3-like isoform X2 [Glycine max] Length = 449 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_003531079.1| PREDICTED: two-pore potassium channel 3-like isoform X1 [Glycine max] Length = 430 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 3/78 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKV-PSPLLFPLPEEGEISLPLPSTPSELKDRLIFGPC--SSSPHDS 361 MEKEPLLPY SP KK P P L PLPE EI LP+ TPSE KDRLIFGP S+SP D Sbjct: 1 MEKEPLLPYFSPRKKPQPFPPLCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPRDP 58 Query: 362 SPIVDALTLSLNSPRSPS 415 SP+ DALTLS NSP+ PS Sbjct: 59 SPLADALTLSYNSPKCPS 76 >ref|XP_007158971.1| hypothetical protein PHAVU_002G197400g [Phaseolus vulgaris] gi|561032386|gb|ESW30965.1| hypothetical protein PHAVU_002G197400g [Phaseolus vulgaris] Length = 389 Score = 93.6 bits (231), Expect = 3e-17 Identities = 52/85 (61%), Positives = 59/85 (69%), Gaps = 2/85 (2%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL--LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDSS 364 MEKEPLLPY SP KK P PL L PLPE E+ LP+ TP E KDRLIFGP +SP D S Sbjct: 1 MEKEPLLPYFSPRKK-PQPLSPLCPLPEHDEMVLPM--TPMEFKDRLIFGPVCASPRDPS 57 Query: 365 PIVDALTLSLNSPRSPSFAFSDHGN 439 P+ DALTL LNSP+ S A D+ + Sbjct: 58 PLADALTLPLNSPKCSSSAAQDYAS 82 >ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] gi|449505938|ref|XP_004162609.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] Length = 425 Score = 93.6 bits (231), Expect = 3e-17 Identities = 58/91 (63%), Positives = 66/91 (72%), Gaps = 4/91 (4%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL---LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDS 361 MEKEPLLPYLSP K PSP+ L PLPE EI+LP+ TP+E KDRLIFGP SSSP D+ Sbjct: 1 MEKEPLLPYLSPRGK-PSPIPPQLCPLPENDEITLPM--TPTEFKDRLIFGP-SSSPQDA 56 Query: 362 SPIVDALTLSLNSPR-SPSFAFSDHGNHVDP 451 SPI DALTLSL+S R S S + D +DP Sbjct: 57 SPIFDALTLSLSSSRPSASSSLQDPSTPLDP 87 >ref|XP_004504709.1| PREDICTED: two-pore potassium channel 3-like isoform X2 [Cicer arietinum] Length = 238 Score = 93.2 bits (230), Expect = 3e-17 Identities = 55/87 (63%), Positives = 60/87 (68%), Gaps = 3/87 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL---LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDS 361 MEKEPLLPY SP KK+ SPL LFPLPE E+ LP+ TPSE KDRLIFGP SP D Sbjct: 1 MEKEPLLPYFSPRKKL-SPLPSHLFPLPENDEMVLPV--TPSEFKDRLIFGPSCVSPIDP 57 Query: 362 SPIVDALTLSLNSPRSPSFAFSDHGNH 442 SP+ DALTLS NSPR S + S H Sbjct: 58 SPLADALTLSRNSPRCSSSSSSSSVPH 84 >ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like isoform X1 [Cicer arietinum] Length = 428 Score = 93.2 bits (230), Expect = 3e-17 Identities = 55/87 (63%), Positives = 60/87 (68%), Gaps = 3/87 (3%) Frame = +2 Query: 191 MEKEPLLPYLSPIKKVPSPL---LFPLPEEGEISLPLPSTPSELKDRLIFGPCSSSPHDS 361 MEKEPLLPY SP KK+ SPL LFPLPE E+ LP+ TPSE KDRLIFGP SP D Sbjct: 1 MEKEPLLPYFSPRKKL-SPLPSHLFPLPENDEMVLPV--TPSEFKDRLIFGPSCVSPIDP 57 Query: 362 SPIVDALTLSLNSPRSPSFAFSDHGNH 442 SP+ DALTLS NSPR S + S H Sbjct: 58 SPLADALTLSRNSPRCSSSSSSSSVPH 84