BLASTX nr result
ID: Paeonia23_contig00016389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00016389 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC16208.1| hypothetical protein L484_024379 [Morus notabilis] 55 8e-06 >gb|EXC16208.1| hypothetical protein L484_024379 [Morus notabilis] Length = 402 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/49 (44%), Positives = 37/49 (75%) Frame = -1 Query: 242 IVINNGSQPNSVSHSLIKELGLKVENHPNPCKVGGIRKRGEFRITKICQ 96 ++IN+GS N VS SL++ L LK E+HP+P ++G I+K E +++K+C+ Sbjct: 159 VIINSGSSENIVSKSLVRALQLKTESHPSPYRIGWIKKGAETKVSKVCR 207