BLASTX nr result
ID: Paeonia23_contig00015872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015872 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307024.2| hypothetical protein POPTR_0005s063002g, par... 57 4e-06 >ref|XP_002307024.2| hypothetical protein POPTR_0005s063002g, partial [Populus trichocarpa] gi|550338239|gb|EEE94020.2| hypothetical protein POPTR_0005s063002g, partial [Populus trichocarpa] Length = 1822 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -2 Query: 148 WDKYPHATLSFKNLGSIDIFACNCLKSIFPPSIASSLVQLRRVEIDSC 5 W+K P TLSF+NL ++ + CN LK++FP SIA LVQL ++EI+ C Sbjct: 534 WNKDPQGTLSFQNLHALKVSDCNVLKNLFPFSIARELVQLEKLEIEHC 581