BLASTX nr result
ID: Paeonia23_contig00015823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015823 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304351.1| PREDICTED: protein N-terminal glutamine amid... 56 6e-06 >ref|XP_004304351.1| PREDICTED: protein N-terminal glutamine amidohydrolase-like isoform 2 [Fragaria vesca subsp. vesca] Length = 230 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = -3 Query: 190 SADGTVHNLNEYIEVEAADVIKKVGVDAFNAVFTQKLGVLL 68 S DGTVHN+++Y ++ A DV+K+ G D NAVFT+K GV++ Sbjct: 177 SEDGTVHNMHDYFDISATDVVKEAGYDMINAVFTEKFGVVI 217