BLASTX nr result
ID: Paeonia23_contig00015680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015680 (1473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322111.2| DEAD box RNA helicase family protein [Populu... 45 3e-06 ref|XP_007034123.1| P-loop containing nucleoside triphosphate hy... 42 3e-06 ref|XP_007034124.1| P-loop containing nucleoside triphosphate hy... 42 3e-06 >ref|XP_002322111.2| DEAD box RNA helicase family protein [Populus trichocarpa] gi|550321941|gb|EEF06238.2| DEAD box RNA helicase family protein [Populus trichocarpa] Length = 710 Score = 45.4 bits (106), Expect(2) = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +3 Query: 1101 KEQKKLTAKRKKEFRDAIQIKEGVEK-PEESVA*KVK 1208 +EQKKL AK +K+FRD ++ KEGVEK PEE+ A K+K Sbjct: 202 REQKKLAAKNEKDFRDELRKKEGVEKNPEEAAAQKLK 238 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 1210 EGTNSYDTFDIMVDCHWSEKR 1272 E + YDTFD+ VD HWSEK+ Sbjct: 240 EAADRYDTFDMRVDRHWSEKK 260 >ref|XP_007034123.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|590655931|ref|XP_007034125.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|590655935|ref|XP_007034126.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508713152|gb|EOY05049.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508713154|gb|EOY05051.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508713155|gb|EOY05052.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 687 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = +3 Query: 1101 KEQKKLTAKRKKEFRDAIQIKEGV-EKPEESVA*KVK 1208 +EQKKL AK +KE R+ I+ KEGV EKPEE+ A ++K Sbjct: 179 REQKKLAAKNEKEMREEIRKKEGVEEKPEEAAAQRLK 215 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1210 EGTNSYDTFDIMVDCHWSEKR 1272 E N+YDTFD+ VD HWSEK+ Sbjct: 217 EAANTYDTFDMRVDKHWSEKK 237 >ref|XP_007034124.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 2 [Theobroma cacao] gi|508713153|gb|EOY05050.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 534 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = +3 Query: 1101 KEQKKLTAKRKKEFRDAIQIKEGV-EKPEESVA*KVK 1208 +EQKKL AK +KE R+ I+ KEGV EKPEE+ A ++K Sbjct: 26 REQKKLAAKNEKEMREEIRKKEGVEEKPEEAAAQRLK 62 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1210 EGTNSYDTFDIMVDCHWSEKR 1272 E N+YDTFD+ VD HWSEK+ Sbjct: 64 EAANTYDTFDMRVDKHWSEKK 84